Gene Literature Dashboard

Viewing February 2024 — 673 paper(s) from the local store. (Local view only — run without --view to fetch new papers.)
← January 2024 March 2024 →
NEGR1
Also flagged:Heart failurenatriuretic peptidesbindingnucleotidesdeathMR
Journal Article 2024-02-29 ✓ 5 Snippets Dib MJ, Levin MG, Zhao L, Diab A, Wang Z, Ebert C, Salman O, Azzo JD, Gan S, Zamani P, Cohen JB, Gill D, Burgess S, Zagkos L, van Empel V, Richards AM, Doughty R, Rietzschel ER, Kammerhoff K, Kvikstad E, Maranville J, Schafer P, Seiffert DA, Ramirez-Valle F, Gordon DA, Chang CP, Javaheri A, Mann DL, Cappola TP, Chirinos JA.
In-Text Gene Mentions

NEGR1 has been suggested to regulate cellular fat content via CD36 expression regulation, and its gene NEGR1 has been identified as a risk locus for obesity in genome‐wide association studies.

In human studies, rs10789336 in NEGR1 was associated with expression levels of RPL31P12 in brain tissues, and with the risk for major depressive disorder,55 implying shared genetic liability between mood disorders and cardiovascular disease risk.

…HR=0.82, P <0.0001),neuronal growth regulator 1growth regulator 1…

…growth regulator 1 (NEGR1; Std HR=0.82; P…

…enetically-predicted levels ofNEGR1, SVEP1 and alcohol…

Show Full Abstract

<h4>Background</h4>Identifying novel molecular drivers of disease progression in heart failure (HF) is a high-priority goal that may provide new therapeutic targets to improve patient outcomes. The authors investigated the relationship between plasma proteins and adverse outcomes in HF and their putative causal role using Mendelian randomization.<h4>Methods and results</h4>The authors measured 4776 plasma proteins among 1964 participants with HF with a reduced left ventricular ejection fraction enrolled in PHFS (Penn Heart Failure Study). Assessed were the observational relationship between plasma proteins and (1) all-cause death or (2) death or HF-related hospital admission (DHFA). The authors replicated nominally significant associations in the Washington University HF registry (N=1080). Proteins significantly associated with outcomes were the subject of 2-sample Mendelian randomization and colocalization analyses. After correction for multiple testing, 243 and 126 proteins were found to be significantly associated with death and DHFA, respectively. These included small ubiquitin-like modifier 2 (standardized hazard ratio [sHR], 1.56; <i>P</i><0.0001), growth differentiation factor-15 (sHR, 1.68; <i>P</i><0.0001) for death, A disintegrin and metalloproteinase with thrombospondin motifs-like protein (sHR, 1.40; <i>P</i><0.0001), and pulmonary-associated surfactant protein C (sHR, 1.24; <i>P</i><0.0001) for DHFA. In pathway analyses, top canonical pathways associated with death and DHFA included fibrotic, inflammatory, and coagulation pathways. Genomic analyses provided evidence of nominally significant associations between levels of 6 genetically predicted proteins with DHFA and 11 genetically predicted proteins with death.<h4>Conclusions</h4>This study implicates multiple novel proteins in HF and provides preliminary evidence of associations between genetically predicted plasma levels of 17 candidate proteins and the risk for adverse outcomes in human HF.

CCPG1
Also flagged:α-SynucleinParkinson's diseasePDage-related neurodegenerative disorderLewy bodyα-syn
Journal Article 2024-02-29 ✓ 1 Snippet Zalon AJ, Quiriconi DJ, Pitcairn C, Mazzulli JR.
In-Text Gene Mentions

CCPG1

Show Full Abstract

Parkinson's disease (PD) is a common age-related neurodegenerative disorder characterized by the loss of dopaminergic neurons in the midbrain. A hallmark of both familial and sporadic PD is the presence of Lewy body inclusions composed mainly of aggregated α-synuclein (α-syn), a presynaptic protein encoded by the <i>SNCA</i> gene. The mechanisms driving the relationship between α-syn accumulation and neurodegeneration are not completely understood, although recent evidence indicates that multiple branches of the proteostasis pathway are simultaneously perturbed when α-syn aberrantly accumulates within neurons. Studies from patient-derived midbrain cultures that develop α-syn pathology through the endogenous expression of PD-causing mutations show that proteostasis disruption occurs at the level of synthesis/folding in the endoplasmic reticulum (ER), downstream ER-Golgi trafficking, and autophagic-lysosomal clearance. Here, we review the fundamentals of protein transport, highlighting the specific steps where α-syn accumulation may intervene and the downstream effects on proteostasis. Current therapeutic efforts are focused on targeting single pathways or proteins, but the multifaceted pathogenic role of α-syn throughout the proteostasis pathway suggests that manipulating several targets simultaneously will provide more effective disease-modifying therapies for PD and other synucleinopathies.

Also flagged:Nucleotidemetabolismimmune responseinheritedinfectionAicardi Goutières syndrome
Journal Article 2024-02-29 No Snippets Gavazzi F, Gonzalez CD, Arnold K, Swantkowski M, Charlton L, Modesti N, Dar AA, Vanderver A, Bennett M, Adang LA.
Show Full Abstract

The balance between a protective and a destructive immune response can be precarious, as exemplified by inborn errors in nucleotide metabolism. This class of inherited disorders, which mimics infection, can result in systemic injury and severe neurologic outcomes. The most common of these disorders is Aicardi Goutières syndrome (AGS). AGS results in a phenotype similar to "TORCH" infections (Toxoplasma gondii, Other [Zika virus (ZIKV), human immunodeficiency virus (HIV)], Rubella virus, human Cytomegalovirus [HCMV], and Herpesviruses), but with sustained inflammation and ongoing potential for complications. AGS was first described in the early 1980s as familial clusters of "TORCH" infections, with severe neurology impairment, microcephaly, and basal ganglia calcifications (Aicardi & Goutières, Ann Neurol, 1984;15:49-54) and was associated with chronic cerebrospinal fluid (CSF) lymphocytosis and elevated type I interferon levels (Goutières et al., Ann Neurol, 1998;44:900-907). Since its first description, the clinical spectrum of AGS has dramatically expanded from the initial cohorts of children with severe impairment to including individuals with average intelligence and mild spastic paraparesis. This broad spectrum of potential clinical manifestations can result in a delayed diagnosis, which families cite as a major stressor. Additionally, a timely diagnosis is increasingly critical with emerging therapies targeting the interferon signaling pathway. Despite the many gains in understanding about AGS, there are still many gaps in our understanding of the cell-type drivers of pathology and characterization of modifying variables that influence clinical outcomes and achievement of timely diagnosis.

CACNA1E
Also flagged:Gene Expressionneuropeptidetranscription factorhomeodomain transcription factorcell bodyaxonal projections
Journal Article 2024-02-29 ✓ 1 Snippet Smith JJ, Taylor SR, Blum JA, Feng W, Collings R, Gitler AD, Miller DM, Kratsios P.
In-Text Gene Mentions

…Ptchd4, Etl4, Grm5,Cacna1e, Kcnh7, Cpne4, Grik1,…

Show Full Abstract

Motor neurons (MNs) constitute an ancient cell type targeted by multiple adult-onset diseases. It is therefore important to define the molecular makeup of adult MNs in animal models and extract organizing principles. Here, we generate a comprehensive molecular atlas of adult Caenorhabditis elegans MNs and a searchable database. Single-cell RNA sequencing of 13,200 cells reveals that ventral nerve cord MNs cluster into 29 molecularly distinct subclasses. Extending C. elegans Neuronal Gene Expression Map and Network (CeNGEN) findings, all MN subclasses are delineated by distinct expression codes of either neuropeptide or transcription factor gene families. Strikingly, combinatorial codes of homeodomain transcription factor genes succinctly delineate adult MN diversity in both C. elegans and mice. Further, molecularly defined MN subclasses in C. elegans display distinct patterns of connectivity. Hence, our study couples the connectivity map of the C. elegans motor circuit with a molecular atlas of its constituent MNs and uncovers organizing principles and conserved molecular codes of adult MN diversity.

SERPINC1
Also flagged:carbonCarbon dioxidemethaneCOVID-19-19degradation
Journal Article 2024-02-29 ✓ 5 Snippets Huo C, Ferreira P, Ul Haq I.
In-Text Gene Mentions

…significant, except forATIIIand RBI, showing…

…price returns ofATIIIand RBI.…

…among these pairs (ATIII-WEGSLI, ATIII-WLCTI, ATIII-WL…

…these pairs (ATIII-WEGSLI,ATIII-WLCTI, ATIII-WLCLI, ATIII-SII…

…rs (ATIII-WEGSLI, ATIII-WLCTI,ATIII-WLCLI, ATIII-SII and ATIII-S&…

Show Full Abstract

This study is aimed at investigating the asymmetric and time-frequency co-movements and the hedge or safe-haven properties of carbon efficient indices, the MSCI ACWI Sustainable Impact, and MSCI World EGS indices, in relation to technology and innovation-themed investments. In doing so, the ADCC-GJR-GARCH and wavelet coherence techniques are applied to a daily return series ranging from January 2019 to January 2023. Findings of the ADCC-GJR-GARCH model show negative and insignificant asymmetric linkage among underlying indices during the sample period. The S&P 500 carbon efficient index (CEI) acts as a strong hedge or safe-haven for technology and innovation-themed indices during tranquil and tumultuous periods. The MSCI ACWI Sustainable Impact, MSCI World EGS, and carbon efficient indices except for S&P 500 CEI exhibit weak hedge or safe-haven attributes. Wavelet coherence reveals negative (positive) co-movements between the thematic and carbon efficient indices in short-term (medium-term and long-term) horizons with consistent leading behavior of thematic indices to carbon efficient indices outcomes. It justifies the presence of short-lived hedging or safe-haven characteristics in the thematic domain for investors. These strong and weak hedge or safe-haven characteristics of low carbon and sustainability indices reveal that adding low carbon efficient and sustainable investments to a portfolio result in considerable diversification benefits for investors who tend to take minimal risk in both tranquil and tumultuous periods. The current findings imply that financial institutions, thematic investing companies, and governments need to encourage carbon efficient technology transfer and innovation-themed investments by increasing the fund allocations in underlying asset classes. Policy-making and regulatory bodies can encourage investors to make carbon-efficient and thematic investments and companies to issue carbon-efficient stocks or investments to safeguard social and economic risks during fragile periods. These investments can offer greater opportunities to combat the intensity of economic shocks on portfolios for responsible or sustainable investors.

Also flagged:glucosidasecoumarins-hydroxypopulene
Journal Article 2024-02-29 No Snippets Le HTT, Hioki Y, Nguyen DV, Le TK, Nguyen VK, Dang TT, Nguyen TA, Nguyen TH, Vu TH, Pham TK, Kita M, Chavasiri W.
Show Full Abstract

Five coumarins were isolated from the heartwood of <i>Mansonia gagei</i>, which included two newly discovered compounds, namely 11-hydroxypopulene E (<b>1</b>) and mansorin D (<b>2</b>), along with three previously identified compounds. The structures were determined through the utilisation of comprehensive spectroscopic data, ECD calculations, and a thorough comparison with existing literature data. The <i>α</i>-glucosidase inhibitory activities of all isolated compounds were assessed in yeast. Out of the compounds tested, compound <b>2</b> exhibited the most significant activity, displaying a percentage inhibition of 34.33% at a concentration of 200 μM.

FBXL4
Also flagged:mitochondrialmitochondriaautophagylysosomemitophagySKP1
Journal Article 2024-02-29 ✓ 5 Snippets Kulkarni P, Nguyen-Dien GT, Kozul KL, Pagan JK.
In-Text Gene Mentions

The post-translational regulation of BNIP3L and BNIP3 is disrupted in mitochondrial DNA depletion syndrome 13 (MTDPS13), a multi-systemic disorder caused by mutations in the FBXL4 gene and characterized by elevated mitophagy and mitochondrial DNA/mtDNA depletion in patient fibroblasts.

Exploring the therapeutic potential of targeting the increased mitophagy observed in the FBXL4-associated MTDPS13 disorder, an incurable disease at present, is an area of significant interest.

FBXL4: safeguarding against mitocho…

…hat the SKP1-CUL1-F-box (SCF)-FBXL4(F-box and leucine-rich…

… SKP1-CUL1-F-box (SCF)-FBXL4 (F-box and leucine-rich repeat protein 4and leucine-rich repeat…

Show Full Abstract

Mitophagy is a critical mitochondrial quality control process that selectively removes dysfunctional or excess mitochondria through the autophagy-lysosome system. The process is tightly controlled to ensure cellular and physiological homeostasis. Insufficient mitophagy can result in failure to remove damaged mitochondria and consequent cellular degeneration, but it is equally important to appropriately restrain mitophagy to prevent excessive mitochondrial depletion. Here, we discuss our recent discovery that the SKP1-CUL1-F-box (SCF)-FBXL4 (F-box and leucine-rich repeat protein 4) E3 ubiquitin ligase localizes to the mitochondrial outer membrane, where it constitutively mediates the ubiquitination and degradation of BNIP3L/NIX and BNIP3 mitophagy receptors to suppress mitophagy. The post-translational regulation of BNIP3L and BNIP3 is disrupted in mitochondrial DNA depletion syndrome 13 (MTDPS13), a multi-systemic disorder caused by mutations in the <i>FBXL4</i> gene and characterized by elevated mitophagy and mitochondrial DNA/mtDNA depletion in patient fibroblasts. Our results demonstrate that mitophagy is not solely stimulated in response to specific conditions but is instead also actively suppressed through the continuous degradation of BNIP3L and BNIP3 mediated by the SCF-FBXL4 ubiquitin ligase. Thus, cellular conditions or signaling events that prevent the FBXL4-mediated turnover of BNIP3L and BNIP3 on specific mitochondria are expected to facilitate their selective removal.

Also flagged:spinal muscular atrophySMN2oligonucleotidebindinghnRNP A1U1
Journal Article 2024-02-29 No Snippets Ishigami Y, Wong MS, Martí-Gómez C, Ayaz A, Kooshkbaghi M, Hanson SM, McCandlish DM, Krainer AR, Kinney JB.
Show Full Abstract

Drugs that target pre-mRNA splicing hold great therapeutic potential, but the quantitative understanding of how these drugs work is limited. Here we introduce mechanistically interpretable quantitative models for the sequence-specific and concentration-dependent behavior of splice-modifying drugs. Using massively parallel splicing assays, RNA-seq experiments, and precision dose-response curves, we obtain quantitative models for two small-molecule drugs, risdiplam and branaplam, developed for treating spinal muscular atrophy. The results quantitatively characterize the specificities of risdiplam and branaplam for 5' splice site sequences, suggest that branaplam recognizes 5' splice sites via two distinct interaction modes, and contradict the prevailing two-site hypothesis for risdiplam activity at SMN2 exon 7. The results also show that anomalous single-drug cooperativity, as well as multi-drug synergy, are widespread among small-molecule drugs and antisense-oligonucleotide drugs that promote exon inclusion. Our quantitative models thus clarify the mechanisms of existing treatments and provide a basis for the rational development of new therapies.

Also flagged:Ferroptosisdeathlipidcancerironnecroptosis
Journal Article 2024-02-29 No Snippets Dai E, Chen X, Linkermann A, Jiang X, Kang R, Kagan VE, Bayir H, Yang WS, Garcia-Saez AJ, Ioannou MS, Janowitz T, Ran Q, Gu W, Gan B, Krysko DV, Zhu X, Wang J, Krautwald S, Toyokuni S, Xie Y, Greten FR, Yi Q, Schick J, Liu J, Gabrilovich DI, Liu J, Zeh HJ, Zhang DD, Yang M, Iovanna J, Kopf M, Adolph TE, Chi JT, Li C, Ichijo H, Karin M, Sankaran VG, Zou W, Galluzzi L, Bush AI, Li B, Melino G, Baehrecke EH, Lotze MT, Klionsky DJ, Stockwell BR, Kroemer G, Tang D.
Show Full Abstract

Ferroptosis, an intricately regulated form of cell death characterized by uncontrolled lipid peroxidation, has garnered substantial interest since this term was first coined in 2012. Recent years have witnessed remarkable progress in elucidating the detailed molecular mechanisms that govern ferroptosis induction and defence, with particular emphasis on the roles of heterogeneity and plasticity. In this Review, we discuss the molecular ecosystem of ferroptosis, with implications that may inform and enable safe and effective therapeutic strategies across a broad spectrum of diseases.

LRRC7
Also flagged:methylationhistonetranscription factorsmetabolismtransportermembrane traffic protein
Journal Article 2024-02-29 ✓ 1 Snippet Ayyappan V, Sripathi VR, Xie S, Saha MC, Hayford R, Serba DD, Subramani M, Thimmapuram J, Todd A, Kalavacharla VK.
In-Text Gene Mentions

…84 ]; 2)Condensin, subunit H, is…

Show Full Abstract

<h4>Background</h4>Switchgrass (Panicum virgatum L.) is a warm-season perennial (C4) grass identified as an important biofuel crop in the United States. It is well adapted to the marginal environment where heat and moisture stresses predominantly affect crop growth. However, the underlying molecular mechanisms associated with heat and drought stress tolerance still need to be fully understood in switchgrass. The methylation of H3K4 is often associated with transcriptional activation of genes, including stress-responsive. Therefore, this study aimed to analyze genome-wide histone H3K4-tri-methylation in switchgrass under heat, drought, and combined stress.<h4>Results</h4>In total, ~ 1.3 million H3K4me3 peaks were identified in this study using SICER. Among them, 7,342; 6,510; and 8,536 peaks responded under drought (DT), drought and heat (DTHT), and heat (HT) stresses, respectively. Most DT and DTHT peaks spanned 0 to + 2000 bases from the transcription start site [TSS]. By comparing differentially marked peaks with RNA-Seq data, we identified peaks associated with genes: 155 DT-responsive peaks with 118 DT-responsive genes, 121 DTHT-responsive peaks with 110 DTHT-responsive genes, and 175 HT-responsive peaks with 136 HT-responsive genes. We have identified various transcription factors involved in DT, DTHT, and HT stresses. Gene Ontology analysis using the AgriGO revealed that most genes belonged to biological processes. Most annotated peaks belonged to metabolite interconversion, RNA metabolism, transporter, protein modifying, defense/immunity, membrane traffic protein, transmembrane signal receptor, and transcriptional regulator protein families. Further, we identified significant peaks associated with TFs, hormones, signaling, fatty acid and carbohydrate metabolism, and secondary metabolites. qRT-PCR analysis revealed the relative expressions of six abiotic stress-responsive genes (transketolase, chromatin remodeling factor-CDH3, fatty-acid desaturase A, transmembrane protein 14C, beta-amylase 1, and integrase-type DNA binding protein genes) that were significantly (P < 0.05) marked during drought, heat, and combined stresses by comparing stress-induced against un-stressed and input controls.<h4>Conclusion</h4>Our study provides a comprehensive and reproducible epigenomic analysis of drought, heat, and combined stress responses in switchgrass. Significant enrichment of H3K4me3 peaks downstream of the TSS of protein-coding genes was observed. In addition, the cost-effective experimental design, modified ChIP-Seq approach, and analyses presented here can serve as a prototype for other non-model plant species for conducting stress studies.

SUDS3
Also flagged:chemotaxisDiabetesatherosclerosissucrosechemokinesCcl3
Journal Article 2024-02-29 ✓ 1 Snippet Chen J, Jamaiyar A, Wu W, Hu Y, Zhuang R, Sausen G, Cheng HS, de Oliveira Vaz C, Pérez-Cremades D, Tzani A, McCoy MG, Assa C, Eley S, Randhawa V, Lee K, Plutzky J, Hamburg NM, Sabatine MS, Feinberg MW.
In-Text Gene Mentions

…emodeling complexes, includingpolycomb repressiverepressive complexes, and…

Show Full Abstract

Diabetes-associated atherosclerosis involves excessive immune cell recruitment and plaque formation. However, the mechanisms remain poorly understood. Transcriptomic analysis of the aortic intima in Ldlr<sup>-/-</sup> mice on a high-fat, high-sucrose-containing (HFSC) diet identifies a macrophage-enriched nuclear long noncoding RNA (lncRNA), MERRICAL (macrophage-enriched lncRNA regulates inflammation, chemotaxis, and atherosclerosis). MERRICAL expression increases by 249% in intimal lesions during progression. lncRNA-mRNA pair genomic mapping reveals that MERRICAL positively correlates with the chemokines Ccl3 and Ccl4. MERRICAL-deficient macrophages exhibit lower Ccl3 and Ccl4 expression, chemotaxis, and inflammatory responses. Mechanistically, MERRICAL guides the WDR5-MLL1 complex to activate CCL3 and CCL4 transcription via H3K4me3 modification. MERRICAL deficiency in HFSC diet-fed Ldlr<sup>-/-</sup> mice reduces lesion formation by 74% in the aortic sinus and 86% in the descending aorta by inhibiting leukocyte recruitment into the aortic wall and pro-inflammatory responses. These findings unveil a regulatory mechanism whereby a macrophage-enriched lncRNA potently inhibits chemotactic responses, alleviating lesion progression in diabetes.

Also flagged:methylationgene expressionviral infectionmaternal infectionNRBP1EIF4G1
Journal Article 2024-02-29 No Snippets Alsegehy S, Southey BR, Hernandez AG, Rund LA, Antonson AM, Nowak RA, Johnson RW, Rodriguez-Zas SL.
Show Full Abstract

DNA methylation is an epigenetic modification that can alter gene expression, and the incidence can vary across developmental stages, inflammatory conditions, and sexes. The effects of viral maternal viral infection and sex on the DNA methylation patterns were studied in the hypothalamus of a pig model of immune activation during development. DNA methylation at single-base resolution in regions of high CpG density was measured on 24 individual hypothalamus samples using reduced representation bisulfite sequencing. Differential over- and under-methylated sites were identified and annotated to proximal genes and corresponding biological processes. A total of 120 sites were differentially methylated (FDR-adjusted p-value < 0.05) between maternal infection or sex groups. Among the 66 sites differentially methylated between groups exposed to inflammatory signals and control, most sites were over-methylated in the challenged group and included sites in the promoter regions of genes SIRT3 and NRBP1. Among the 54 differentially methylated sites between females and males, most sites were over-methylated in females and included sites in the promoter region of genes TNC and EIF4G1. The analysis of the genes proximal to the differentially methylated sites suggested that biological processes potentially impacted include immune response, neuron migration and ensheathment, peptide signaling, adaptive thermogenesis, and tissue development. These results suggest that translational studies should consider that the prolonged effect of maternal infection during gestation may be enacted through epigenetic regulatory mechanisms that may differ between sexes.

TNFSF4
Also flagged:methylationgastric adenocarcinomamalignant tumorStomach adenocarcinomaSTADgastric cancer
Journal Article 2024-02-29 ✓ 1 Snippet He X, Chen X, Yang C, Wang W, Sun H, Wang J, Fu J, Dong H.
In-Text Gene Mentions

…, TNFRSF13B ,TNFSF4( Figs. S5A…

Show Full Abstract

<h4>Background</h4>Gastric cancer (GC) is a malignant tumor that originates from the epithelium of the gastric mucosa and has a poor prognosis. Stomach adenocarcinoma (STAD) covers 95% of total gastric cancer. This study aimed to identify the prognostic value of RNA methylation-related genes in gastric cancer.<h4>Methods</h4>In this study, The Cancer Genome Atlas (TCGA)-STAD and GSE84426 cohorts were downloaded from public databases. Patients were classified by consistent cluster analysis based on prognosis-related differentially expressed RNA methylation genes Prognostic genes were obtained by differential expression, univariate Cox and least absolute shrinkage and selection operator (LASSO) analyses. The prognostic model was established and validated in the training set, test set and validation set respectively. Independent prognostic analysis was implemented. Finally, the expression of prognostic genes was affirmed by reverse transcription quantitative PCR (RT-qPCR).<h4>Results</h4>In total, four prognostic genes (<i>ACTA2</i>, <i>SAPCD2</i>, <i>PDK4</i> and <i>APOD</i>) related to RNA methylation were identified and enrolled into the risk signature. The STAD patients were divided into high- and low-risk groups based on the medium value of the risk score, and patients in the high-risk group had a poor prognosis. In addition, the RNA methylation-relevant risk signature was validated in the test and validation sets, and was authenticated as a reliable independent prognostic predictor. The nomogram was constructed based on the independent predictors to predict the 1/3/5-year survival probability of STAD patients. The gene set enrichment analysis (GSEA) result suggested that the poor prognosis in the high-risk subgroup may be related to immune-related pathways. Finally, the experimental results indicated that the expression trends of RNA methylation-relevant prognostic genes in gastric cancer cells were in agreement with the result of bioinformatics.<h4>Conclusion</h4>Our study established a novel RNA methylation-related risk signature for STAD, which was of considerable significance for improving prognosis of STAD patients and offering theoretical support for clinical therapy.

Also flagged:Acute Myeloid LeukemiaAMLclonal disordermyeloid neoplasmmyelodysplasiaAML not otherwise specified
Journal Article 2024-02-29 No Snippets Chaudhary S, Chaudhary P, Ahmad F, Arora N.
Show Full Abstract

Acute myeloid leukemia (AML) is a genetically heterogeneous clonal disorder characterized by the accumulation of acquired somatic genetic alterations in hematopoietic progenitor cells, which alter the normal mechanisms of self-renewal, proliferation, and differentiation. Due to significant technological advancements in sequencing technologies in the last 2 decades, classification and prognostic scoring of AML has been refined, and multiple guidelines are now available for the same. The authors have tried to summarize, latest guidelines for AML diagnosis, important markers associated, epigenetics markers, various AML fusions and their importance, etc. Review of literature suggests lack of study or comprehensive information about current NGS panels for AML diagnosis, genes and fusions covered, their technical know-how, etc. To solve this issue, the authors have tried to present detailed review about currently in use next-generation sequencing myeloid panels and their offerings.

TNFSF4
Also flagged:TREM1cancerMAPKgastric cancergene silencingcell proliferation
Journal Article 2024-02-29 ✓ 1 Snippet Chen L, Huang F, Luo X, Chen Z.
In-Text Gene Mentions

…LAIR1, CD200R1, PDCD1LG2,TNFSF4, SIRPA, and TNFSF18)…

Show Full Abstract

<h4>Background</h4>CD molecules plays a vital role in gastric cancer (GC). We used bioinformatics analysis methods to develop prognosis related CD molecules risk signature; On the other hand, we used the experiments to further explore the function and mechanism of differentially expressed prognostic CD molecules (TREM1) in GC.<h4>Methods</h4>Kaplan-Meier survival and univariate Cox regression analysis were used to evaluate the overall survival of CD molecule genes in gastric cancer. ROC curve and Kaplan-Meier curves were used to analyze the predictive value of CD molecule related genes risk signature by "survival and timeROC" R packages. GSEA, and Cibersortx software were used to analyze the functional enrichment. Finally, we verified the function and mechanism of TREM1 in GC by gene silencing and MAPK inhibitor (SB203580) in vitro and vivo.<h4>Results</h4>A total of 41 prognosis related risk factors in gastric cancer were identified based on CD molecules, including TREM1 and ect. The high-risk patients had higher risk score and shorter survival time. ROC curves revealed that this risk signature accurately predicted survival times of gastric cancer patients at the 1-, 2-, 3-, 4- and 5-year. The frequency of T cells follicular helper and NK cells activated were added in low-risk group. Next, differentially expressed prognostic CD molecules analysis revealed that TREM1 was identified as key genes in GC progression based on TCGA and GES158662 and GSE15459 datasets of GC. In vitro experiments, TREM1 silencing significantly inhibited GC cell proliferation and migration, induced cell apoptosis. GSEA revealed that TREM1 activated cancer related signaling pathway, including MAPK signaling pathway and ect. High expression of TREM1 was related Macrophages M2 and Mast cells resting in GC tissues. Moreover, knockdown of TREM1 inhibited tumor growth through downregulated MAPK signaling pathway in vivo.<h4>Conclusion</h4>These results identified that CD molecule related genes as a novel prognostic and diagnostic biomarker in gastric cancer. TREM1 acts as an oncogene role in GC by activated MAPK signaling pathway.

Also flagged:β-tubulinTUBBhexaneglycoproteinergosterolperoxide
Journal Article 2024-02-29 No Snippets Tang SM, Chen DC, Wang S, Wu XQ, Ao CC, Li EX, Luo HM, Li SH.
Show Full Abstract

Species of <i>Grifola</i> are famous edible mushrooms and are deeply loved by consumers around the world. Most species of this genus have been described and recorded in Oceania, Europe and South America, with only <i>Grifolafrondosa</i> being recorded in Asia. In this study, two novel species of <i>Grifola</i> from southwestern China (Asia) are introduced. Macro and micromorphological characters are described. <i>Grifolaedulis</i><b>sp. nov.</b> present medium-size basidiomata with gray to gray-brown lobes upper surface, mostly tibiiform or narrowly clavate, rarely narrowly lageniform or ellipsoid chlamydospores, cuticle hyphae terminal segments slightly enlarged. <i>Grifolasinensis</i><b>sp. nov.</b> has white to grayish white lobes upper surface, mostly ellipsoid, rarely narrowly utriform chlamydospores, and broadly ellipsoid to ellipsoid basidiospores (4.6-7.9 × 3.0-5.9 μm). The two new species are supported by phylogenetic analyses of combined nuclear rDNA internal transcribed spacer ITS1-5.8S-ITS2 rDNA (ITS) and β-tubulin (<i>TUBB</i>). Moreover, the genetic distance between <i>TUBB</i> sequences of those specimen from GenBank was 1.76-1.9%. Thus, the conspecificity relationship of our specimens remains uncertain, and further specimens are required to conclusively confirm its identity.

Also flagged:Knee osteoarthritisOAOsteoarthritisobesitycongenital disordersmethyl-methacrylate
Journal Article 2024-02-29 No Snippets Wilczyński M, Bieniek M, Krakowski P, Karpiński R.
Show Full Abstract

Knee osteoarthritis (OA) is one of the leading causes of disability around the globe. Osteoarthritis is mainly considered a disease affecting the elderly. However, more and more studies show that sports overuse, obesity, or congenital disorders can initiate a pathologic cascade that leads to OA changes in the younger population. Nevertheless, OA mostly affects the elderly, and with increasing life expectancy, the disease will develop in more and more individuals. To date, the golden standard in the treatment of the end-stage of the disease is total joint replacement (TJR), which restores painless knee motion and function. One of the weakest elements in TJR is its bonding with the bone, which can be achieved by bonding material, such as poly methyl-methacrylate (PMMA), or by cementless fixation supported by bone ingrowth onto the endoprosthesis surface. Each technique has its advantages; however, the most important factor is the revision rate and survivor time. In the past, numerous articles were published regarding TJR revision rate, but no consensus has been established yet. In this review, we focused on a comparison of cemented and cementless total knee replacement surgeries. We introduced PICO rules, including population, intervention, comparison and outcomes of TJR in a PubMed search. We identified 783 articles published between 2010 and 2023, out of which we included 14 in our review. Our review reveals that there is no universally prescribed approach to fixate knee prostheses. The determination of the most suitable method necessitates an individualized decision-making process involving the active participation and informed consent of each patient.

B4GALT5
Also flagged:ProteoglycanLumicancollagencell surface receptorscell proliferationinfection
Journal Article 2024-02-29 ✓ 1 Snippet Smith MM, Melrose J.
In-Text Gene Mentions

B4GALT5 is highly expressed in hepatic carcinoma [45], catalyzing the biosynthesis of lactosylceramide via the transfer of galactose from UDP-galactose to glucosylceramide, a central intermediate in the biosynthesis of complex sphingolipids and gangliosides.

Show Full Abstract

This study has reviewed the many roles of lumican as a biomarker of tissue pathology in health and disease. Lumican is a structure regulatory proteoglycan of collagen-rich tissues, with cell instructive properties through interactions with a number of cell surface receptors in tissue repair, thereby regulating cell proliferation, differentiation, inflammation and the innate and humoral immune systems to combat infection. The exponential increase in publications in the last decade dealing with lumican testify to its role as a pleiotropic biomarker regulatory protein. Recent findings show lumican has novel roles as a biomarker of the hypercoagulative state that occurs in SARS CoV-2 infections; thus, it may also prove useful in the delineation of the complex tissue changes that characterize COVID-19 disease. Lumican may be useful as a prognostic and diagnostic biomarker of long COVID disease and its sequelae.

POU3F2
Also flagged:neurodevelopmental congenital disorderzinc finger E-box binding homeobox 2SMAD-binding proteinbindinghematopoiesisZEB2
Journal Article 2024-02-29 ✓ 2 Snippets St Peter C, Hossain WA, Lovell S, Rafi SK, Butler MG.
In-Text Gene Mentions

…, 45 ];POU3F2( POU3F2 ;…

…]; POU3F2 (POU3F2; NM_005604.4) is…

Show Full Abstract

Mowat-Wilson syndrome (MWS) is a rare genetic neurodevelopmental congenital disorder associated with various defects of the zinc finger E-box binding homeobox 2 (<i>ZEB2</i>) gene. The <i>ZEB2</i> gene is autosomal dominant and encodes six protein domains including the SMAD-binding protein, which functions as a transcriptional corepressor involved in the conversion of neuroepithelial cells in early brain development and as a mediator of trophoblast differentiation. This review summarizes reported <i>ZEB2</i> gene variants, their types, and frequencies among the 10 exons of <i>ZEB2</i>. Additionally, we summarized their corresponding encoded protein defects including the most common variant, c.2083 C>T in exon 8, which directly impacts the homeodomain (HD) protein domain. This single defect was found in 11% of the 298 reported patients with MWS. This review demonstrates that exon 8 encodes at least three of the six protein domains and accounts for 66% (198/298) of the variants identified. More than 90% of the defects were due to nonsense or frameshift changes. We show examples of protein modeling changes that occurred as a result of <i>ZEB2</i> gene defects. We also report a novel pathogenic variant in exon 8 in a 5-year-old female proband with MWS. This review further explores other genes predicted to be interacting with the <i>ZEB2</i> gene and their predicted gene-gene molecular interactions with protein binding effects on embryonic multi-system development such as craniofacial, spine, brain, kidney, cardiovascular, and hematopoiesis.

GPR52
Also flagged:Orphan G protein-coupled receptorsG protein-coupled receptorsGPCRstransmembrane receptorsGPCRtransmembrane
Journal Article 2024-02-29 ✓ 3 Snippets Jobe A, Vijayan R.
In-Text Gene Mentions

Interestingly, the constitutive activity of GPR52 which is implicated in Huntington’s disease is based on its self-activation (Lin et al., 2020) resulting from the presence of a ligand-like motif in ECL2 filling the orthosteric cavity, though the receptor also has a ligand-binding side pocket (Lin et al., 2020).

GPR17 also exhibits a similar phenomenon (Ye et al., 2022), and so does type 2 diabetes-associated GPR21, the only homolog of GPR52 sharing 70% sequence identity (Wong et al., 2023).

…of human orphanGPR52in different states—ligand-fre…

Show Full Abstract

G protein-coupled receptors (GPCRs) make up the largest receptor superfamily, accounting for 4% of protein-coding genes. Despite the prevalence of such transmembrane receptors, a significant number remain orphans, lacking identified endogenous ligands. Since their conception, the reverse pharmacology approach has been used to characterize such receptors. However, the multifaceted and nuanced nature of GPCR signaling poses a great challenge to their pharmacological elucidation. Considering their therapeutic relevance, the search for native orphan GPCR ligands continues. Despite limited structural input in terms of 3D crystallized structures, with advances in machine-learning approaches, there has been great progress with respect to accurate ligand prediction. Though such an approach proves valuable given that ligand scarcity is the greatest hurdle to orphan GPCR deorphanization, the future pairings of the remaining orphan GPCRs may not necessarily take a one-size-fits-all approach but should be more comprehensive in accounting for numerous nuanced possibilities to cover the full spectrum of GPCR signaling.

SLC2A14
Also flagged:Familial Mediterranean feverperiodic fever syndromeIL-1βIL-6chromatinMEFV
Journal Article 2024-02-29 ✓ 2 Snippets Röring RJ, Li W, Liu R, Bruno M, Zhang B, Debisarun PA, Gaal O, Badii M, Klück V, Moorlag SJCFM, van de Veerdonk F, Li Y, Joosten LAB, Netea MG.
In-Text Gene Mentions

The top downregulated genes (unadjusted p value below 1 × 10−5) were GSTM1 (glutathione metabolism), SLC2A14 (a glucose transporter), ACCS (amino acid metabolism), and ZSCAN (transcriptional regulation).

…STM1 (glutathione metabolism),SLC2A14(a glucose transporter),…

Show Full Abstract

Familial Mediterranean fever (FMF) is a periodic fever syndrome caused by variation in <i>MEFV</i>. FMF is known for IL-1β dysregulation, but the innate immune landscape of this disease has not been comprehensively described. Therefore, we studied circulating inflammatory proteins, and the function of monocytes and (albeit less extensively) neutrophils in treated FMF patients in remission. We found that monocyte IL-1β and IL-6 production was enhanced upon stimulation, in concordance with alterations in the plasma inflammatory proteome. We did not observe changes in neutrophil functional assays. Subtle differences in chromatin accessibility and transcriptomics in our small patient cohort further argued for monocyte dysregulation. Together, these observations suggest that the <i>MEFV</i>-mutation-mediated primary immune dysregulation in monocytes leads to chronic inflammation that is subsequently associated with counterregulatory epigenetic/transcriptional changes reminiscent of tolerance. These data increase our understanding of the innate immune changes in FMF, aiding future management of chronic inflammation in these patients.

Also flagged:Non-alcoholic steatohepatitisNASHalcoholic liver diseasemetabolic syndromenon-alcoholic fatty liver diseasecirrhosis
Journal Article 2024-02-29 No Snippets Choudhury A, Singh SP, Desmukh A, Sahoo B, Eslam M.
Show Full Abstract

Non-alcoholic steatohepatitis (NASH) is the second most frequent cause of liver transplantation following alcoholic liver disease. With longer follow-up and increased survival rates, the occurrence rate of the metabolic syndrome is increasing with time among liver transplant recipients. Reappearances of non-alcoholic fatty liver disease after transplantation, both as recurring cases and new instances, are prevalent; nonetheless, the recurrence of fibrosis is minimal. Recognizing populations at elevated risk and enhancing the management of metabolic-related conditions are crucial for maintaining a healthy transplanted organ, particularly considering the prolonged utilization of immunosuppressive treatments. Furthermore, NASH-related cirrhosis patients who had transplant are at a greater risk of cardiovascular, renal events and increased incidence of cancer, necessitating a unique care strategy. This review discusses post-transplant metabolic syndrome, risk factors, pathogenesis, diagnosis, prevention strategy, recurrent and <i>de novo</i> NAFLD and customized immunosuppression.

DCC
Also flagged:p16
Journal Article 2024-02-29 ✓ 1 Snippet Wu H, Feng X, Zhang J.
In-Text Gene Mentions

…-RX block ciphers released by DCC in 2022. …

Show Full Abstract

The SAND algorithm is a family of lightweight AND-RX block ciphers released by DCC in 2022. Our research focuses on assessing the security of SAND with a quantum computation model. This paper presents the first quantum implementation of SAND (including two versions of SAND, SAND-64 and SAND-128). Considering the depth-times-width metric, the quantum circuit implementation of the SAND algorithm demonstrates a relatively lower consumption of quantum resources than that of the quantum implementations of existing lightweight algorithms. A generalized Grover-based brute-force attack framework was implemented and employed to perform attacks on two versions of the SAND algorithm. This framework utilized the g-database algorithm, which considered different plaintext-ciphertext pairs in a unified manner, reducing quantum resource consumption. Our findings indicate that the SAND-128 algorithm achieved the NIST security level I, while the SAND-64 algorithm fell short of meeting the requirements of security level I.

Also flagged:TRPV ChannelsOsteoarthritisOAjoint disordertransient receptor potential vanilloid(TRPV) channels
Journal Article 2024-02-29 No Snippets Chen C, Yang F, Chen R, Yang C, Xiao H, Geng B, Xia Y.
Show Full Abstract

Osteoarthritis (OA) is a debilitating joint disorder that affects millions of people worldwide. Despite its prevalence, our understanding of the underlying mechanisms remains incomplete. In recent years, transient receptor potential vanilloid (TRPV) channels have emerged as key players in OA pathogenesis. This review provides an in-depth exploration of the role of the TRPV pathway in OA, encompassing its involvement in pain perception, inflammation, and mechanotransduction. Furthermore, we discuss the latest research findings, potential therapeutic strategies, and future directions in the field, shedding light on the multifaceted nature of TRPV channels in OA.

Also flagged:TNFEosinophilic asthmaasthmacorticosteroideosinophiliapathogenesis
Journal Article 2024-02-29 No Snippets Matsuyama T, Salter BM, Emami Fard N, Machida K, Sehmi R.
Show Full Abstract

Eosinophilic asthma is the most prevalent and well-defined phenotype of asthma. Despite a majority of patients responding to corticosteroid therapy and T2 biologics, there remains a subset that have recurrent asthma exacerbations, highlighting a need for additional therapies to fully ameliorate airway eosinophilia. Group 2 innate lymphoid cells (ILC2) are considered key players in the pathogenesis of eosinophilic asthma through the production of copious amounts of type 2 cytokines, namely IL-5 and IL-13. ILC2 numbers are increased in the airways of asthmatics and with the greatest numbers of activated ILC2 detected in sputa from severe prednisone-dependent asthma with uncontrolled eosinophilia. Although epithelial-derived cytokines are important mediators of ILC2 activation, emerging evidence suggests that additional pathways stimulate ILC2 function. The tumor necrosis factor super family (TNFSF) and its receptors (TNFRSF) promote ILC2 activity. In this review, we discuss evidence supporting a relationship between ILC2 and TNFSF/TNFRSF axis in eosinophilic asthma and the role of this relationship in severe asthma with airway autoimmune responses.

BTN3A3BTN2A1
Also flagged:MHCtumorgynecologic malignancieschimeric antigen receptortumorsovarian cancer
Journal Article 2024-02-29 ✓ 5 Snippets Conejo-Garcia JR, Anadon CM, Lopez-Bailon LU, Chaurio RA.
In-Text Gene Mentions

Accordingly, CD277 Abs, or zoledronate, which induces the accumulation of BTN3A1-binding isopentenyl pyrophosphate (IPP), restored αβ T-cell effector activity by inducing clustering of BTN3A1 and BTN2A1 that released BTN3A:CD45 engagement [3].

As mentioned above, targeting BTN3A1 with novel human antibodies that promote the formation of a complex of this butyrophilin with BTN2A1 elicited coordinated αβ and Vγ9Vδ2 T cell responses against established ovarian cancer xenografts, including orthotopic tumors [3].

…the ovaries, whereasBTN2A1is expressed in…

…BTN3A1, BTN3A2, andBTN3A3share a similar…

…this butyrophilin andBTN2A1and binds to…

Show Full Abstract

Immuno-oncology has traditionally focused on conventional MHC-restricted αβ T cells. Yet, unconventional γδ T cells, which kill tumor cells in an MHC-unrestricted manner, display characteristics of effector activity and stemness without exhaustion and are nearly universally observed in human gynecologic malignancies, correlating with improved outcomes. These cells do not have a clear counterpart in mice but are also found in the healthy female reproductive tract. Interventions that modulate their in vivo activity, or cellular therapies utilizing γδ T cells as an allogeneic, "off-the-shelf" platform (e.g., for chimeric antigen receptor expression) hold significant potential against challenging tumors like ovarian cancer, which has been stubbornly resistant to the immune checkpoint inhibitors that change the landscape of other human tumors. Here, we discuss recent discoveries on the specific populations of γδ T cells that infiltrate human gynecologic cancers, their anti-tumor activity, and the prospect of redirecting their effector function against tumor cells to develop a new generation of immunotherapies that extends beyond the traditional αβ T cell-centric view of the field.

HTT
Also flagged:Substance UseDrug Dependencesubstance dependencyalcoholmaternal addictionbehavioural
Journal Article 2024-02-29 ✓ 1 Snippet Fadaei-Kenarsary M, Esmaeilpour K, Shabani M, Sheibani V.
In-Text Gene Mentions

…the serotonin transporter (5-HTTor Slc6a4) gene,…

Show Full Abstract

The likelihood of substance dependency in offspring is increased in cases when there is a family history of drug or alcohol use. Mothering is limited by maternal addiction because of the separation. Maternal separation (MS) leads to the development of behavioural and neuropsychiatric issues in the future. Despite the importance of this issue, empirical investigations of the influences of maternal substance use and separation on substance use problems in offspring are limited, and studies that consider both effects are rare. This study aims to review a few studies on the mechanisms, treatments, genetics, epigenetics, molecular and psychological alterations, and neuroanatomical regions involved in the dependence of offspring who underwent maternal addiction and separation. The PubMed database was used. A total of 95 articles were found, including the most related ones in the review. The brain's lateral paragigantocellularis (LPGi), nucleus accumbens (NAc), caudate-putamen (CPu), prefrontal cortex (PFC), and hippocampus, can be affected by MS. Dopamine receptor subtype genes, alcohol biomarker minor allele, and preproenkephalin mRNA may be affected by alcohol or substance use disorders. After early-life adversity, histone acetylation in the hippocampus may be linked to brain-derived neurotrophic factor (BDNF) gene epigenetics and glucocorticoid receptors (GRs). The adverse early-life experiences differ in offspring›s genders and rewire the brain›s dopamine and endocannabinoid circuits, making offspring more susceptible to dependence. Related psychological factors rooted in early-life stress (ELS) and parental substance use disorder (SUD). Treatments include antidepressants, histone deacetylase inhibitors, lamotrigine, ketamine, choline, modafinil, methadone, dopamine, cannabinoid 1 receptor agonists/antagonists, vitamins, oxytocin, tetrahydrocannabinol, SR141716A, and dronabinol. Finally, the study emphasizes the need for multifaceted strategies to prevent these outcomes.

POU3F2
Also flagged:cancerleukemiabreast cancerglioblastomacolorectal cancertumor
Journal Article 2024-02-29 ✓ 2 Snippets Knopik-Skrocka A, Sempowicz A, Piwocka O.
In-Text Gene Mentions

Four transcription factors (POU3F2, SOX2, SALL2, OLIG2) introduced into differentiated glioblastoma cells induced stemness phenotype.

…Four transcription factors (POU3F2, SOX2, SALL2, OLIG2)…

Show Full Abstract

According to the CSC hypothesis, cancer stem cells are pivotal in initiating, developing, and causing cancer recurrence. Since the identification of CSCs in leukemia, breast cancer, glioblastoma, and colorectal cancer in the 1990s, researchers have actively investigated the origin and biology of CSCs. However, the CSC hypothesis and the role of these cells in tumor development model is still in debate. These cells exhibit distinct surface markers, are capable of self-renewal, demonstrate unrestricted proliferation, and display metabolic adaptation. CSC phenotypic plasticity and the capacity to EMT is strictly connected to the stemness state. CSCs show high resistance to chemotherapy, radiotherapy, and immunotherapy. The plasticity of CSCs is significantly influenced by tumor microenvironment factors, such as hypoxia. Targeting the genetic and epigenetic changes of cancer cells, together with interactions with the tumor microenvironment, presents promising avenues for therapeutic strategies. See also the Graphical abstract(Fig. 1).

bioRxiv 2024-02-29 Preprint (No Snippets API) Zazueta RF, Krueger J, Alba DM, Aymerich X, Beck RMD, Cappellini E, Martín GC, Cirilli O, Clark N, Cornejo OE, Farh KK, Ferrández-Peral L, Juan D, Kelley JL, Kuderna LFK, Little J, Orkin JD, Paterson RS, Pawar H, Marques-Bonet T, Lizano E.
Show Full Abstract

Ancient tooth enamel, and to some extent dentin and bone, contain characteristic peptides that persist for long periods of time. In particular, peptides from the enamel proteome (enamelome) have been used to reconstruct the phylogenetic relationships of fossil specimens and to estimate divergence times. However, the enamelome is based on only about 10 genes, whose protein products undergo fragmentation post mortem . Moreover, some of the enamelome genes are paralogous or may coevolve. This raises the question as to whether the enamelome provides enough information for reliable phylogenetic inference. We address these considerations on a selection of enamel-associated proteins that has been computationally predicted from genomic data from 232 primate species. We created multiple sequence alignments (MSAs) for each protein and estimated the evolutionary rate for each site and examined which sites overlap with the parts of the protein sequences that are typically isolated from fossils. Based on this, we simulated ancient data with different degrees of sequence fragmentation, followed by phylogenetic analysis. We compared these trees to a reference species tree. Up to a degree of fragmentation that is similar to that of fossil samples from 1-2 million years ago, the phylogenetic placements of most nodes at family level are consistent with the reference species tree. We found that the composition of the proteome influences the phylogenetic placement of Tarsiiformes. For the inference of molecular phylogenies based on paleoproteomic data, we recommend characterizing the evolution of the proteomes from the closest extant relatives to maximize the reliability of phylogenetic inference.

bioRxiv 2024-02-29 Preprint (No Snippets API) Santos F, Correia M, Dias R, Bola B, Noberini R, Ferreira RS, Domingues P, Teixeira J, Bonaldi T, Oliveira PJ, Bär C, Bernardes de Jesus B, Nóbrega-Pereira S.
Show Full Abstract

<h4>ABSTRACT</h4> Heart disease is the leading cause of mortality in developed countries novel regenerative procedures are warranted for improving patients well fare. Direct cardiac conversion (DCC) can create induced cardiomyocytes (iCMs) and besides holding great promise, lacks clinical effectiveness for cardiac regeneration as metabolic and age-associated barriers remains elusive. Here, we identify by histone post-translational analysis that DCC triggers major age-dependent alterations in the epigenetic landscape. Metabolomics revealed decrease abundance of anabolic metabolites related to TCA cycle and glutaminolysis and profound mitochondrial network remodeling, with increased elongation and interconnectivity and reliance in mitochondrial respiration in iCMs. Importantly, adult-derived iCMs present increase accumulation of oxidative stress in the mitochondria and pharmacological activation of mitophagy increase DCC of adult fibroblasts in vitro . Metabolic modulation in vitro and dietary manipulations in vivo improves DCC efficiency and are accompanied by significant alterations in the histone acetylation and methylation landscape and mitochondria homeostasis. Our study provides evidence that metaboloepigenetics as a direct role in cell fate transitions driving direct cardiac conversion into iCMs, highlighting the potential use of metabolic modulation in increasing cardiac regenerative strategies.

CACNA1E
Also flagged:Obesitycancerpost-menopausal breast cancerlactationmenopausebreast cancer
Journal Article 2024-02-28 ✓ 1 Snippet Meng Y, Toledo-Rodriguez M, Fedorenko O, Smith PA.
In-Text Gene Mentions

…CaV2.1 (Cacna1a), CaV2.3 (Cacna1e), CaV3.1 ( Cacna1g…

Show Full Abstract

White adipose tissue (WAT) requires extracellular Ca2+ influx for lipolysis, differentiation, and expansion. This partly occurs via plasma membrane Ca2+ voltage-dependent channels (CaVs). However, WFA exists in different depots whose function varies with age, sex, and location. To explore whether their CaV expression profiles also differ we used RNAseq and qPCR on gonadal, mesenteric, retroperitoneal, and inguinal subcutaneous fat depots from rats of different ages and sex. CaV expression was found dependent on age, sex, and WFA location. In the gonadal depots of both sexes a significantly lower expression of CaV1.2 and CaV1.3 was seen for adults compared to pre-pubescent juveniles. A lower level of expression was also seen for CaV3.1 in adult male but not female gonadal WFA, the latter of whose expression remained unchanged with age. Relatively little expression of CaV3.2 and 3.2 was observed. In post-pubescent inguinal subcutaneous fat, where the third and fourth mammary glands are located, CaV3.1 was decreased in males but increased in females - thus suggesting that this channel is associated with mammogenesis; however, no difference in intracellular Ca2+ levels or adipocyte size were noted. For all adult depots, CaV3.1 expression was larger in females than males - a difference not seen in pre-pubescent rats. These observations are consistent with the changes of CaV3.1 expression seen in 3T3-L1 cell differentiation and the ability of selective CaV3.1 antagonists to inhibit adipogensis. Our results show that changes in CaV expression patterns occur in fat depots related to sexual dimorphism: reproductive tracts and mammogenesis.

POU3F2
Also flagged:neurogenesisgene expressionBMPFGFWNTtranscription factors
Journal Article 2024-02-28 ✓ 1 Snippet Xu L, Yuan Z, Zhou J, Zhao Y, Liu W, Lu S, He Z, Qiang B, Shu P, Chen Y, Peng X.
In-Text Gene Mentions

…, NEUROG2 ,POU3F2, ETV1 ,…

Show Full Abstract

Despite intense research on mice, the transcriptional regulation of neocortical neurogenesis remains limited in humans and non-human primates. Cortical development in rhesus macaque is known to recapitulate multiple facets of cortical development in humans, including the complex composition of neural stem cells and the thicker supragranular layer. To characterize temporal shifts in transcriptomic programming responsible for differentiation from stem cells to neurons, we sampled parietal lobes of rhesus macaque at E40, E50, E70, E80, and E90, spanning the full period of prenatal neurogenesis. Single-cell RNA sequencing produced a transcriptomic atlas of developing parietal lobe in rhesus macaque neocortex. Identification of distinct cell types and neural stem cells emerging in different developmental stages revealed a terminally bifurcating trajectory from stem cells to neurons. Notably, deep-layer neurons appear in the early stages of neurogenesis, while upper-layer neurons appear later. While these different lineages show overlap in their differentiation program, cell fates are determined post-mitotically. Trajectories analysis from ventricular radial glia (vRGs) to outer radial glia (oRGs) revealed dynamic gene expression profiles and identified differential activation of <i>BMP</i>, <i>FGF</i>, and <i>WNT</i> signaling pathways between vRGs and oRGs. These results provide a comprehensive overview of the temporal patterns of gene expression leading to different fates of radial glial progenitors during neocortex layer formation.

HFE
Also flagged:AmiodaroneDronedaroneLiver InjuryALTDILIfailure
Journal Article 2024-02-28 ✓ 1 Snippet Pop A, Halegoua-DeMarzio D, Barnhart H, Kleiner D, Avigan M, Gu J, Chalasani N, Ahmad J, Fontana RJ, Lee W, Barritt AS, Durazo F, Hayashi PH, Navarro VJ.
In-Text Gene Mentions

…positive for anHFEgene mutation.…

Show Full Abstract

<h4>Objective</h4>To describe hepatotoxicity due to amiodarone and dronedarone from the DILIN and the US FDA's surveillance database.<h4>Methods</h4>Hepatotoxicity due to amiodarone and dronedarone enrolled in the U.S. Drug Induced Liver Injury Network (DILIN) from 2004 to 2020 are described. Dronedarone hepatotoxicity cases associated with liver biopsy results were obtained from the FDA Adverse Event Reporting System (FAERS) from 2009 to 2020.<h4>Results</h4>Among DILIN's 10 amiodarone and 3 dronedarone DILIN cases, the latency for amiodarone was longer than with dronedarone (388 vs 119 days, p = 0.50) and the median ALT at DILI onset was significantly lower with amiodarone (118 vs 1191 U/L, p = 0.05). Liver biopsies in five amiodarone cases showed fibrosis, steatosis, and numerous Mallory-Denk bodies. Five patients died although only one from liver failure. One patient with dronedarone induced liver injury died of a non-liver related cause. Nine additional cases of DILI due to dronedarone requiring hospitalization were identified in the FAERS database. Three patients developed liver injury within a month of starting the medication. Two developed acute liver failure and underwent urgent liver transplant, one was evaluated for liver transplant but then recovered spontaneously, while one patient with cirrhosis died of liver related causes.<h4>Conclusion</h4>Amiodarone hepatotoxicity resembles that seen in alcohol related liver injury, with fatty infiltration and inflammation. Dronedarone is less predictable, typically without fat and with a shorter latency of use before presentation. These differences may be explained, in part, by the differing pharmacokinetics of the two drugs leading to different mechanisms of hepatotoxicity.

Also flagged:viral infectioninfectionHSV-1 infectioninfectionsviral infectionsgene expression
Journal Article 2024-02-28 No Snippets Fredrikson JP, Domanico LF, Pratt SL, Loveday EK, Taylor MP, Chang CB.
Show Full Abstract

Single-cell analyses of viral infections reveal heterogeneity that is not detected by traditional population-level studies. This study applies drop-based microfluidics to investigate the dynamics of herpes simplex virus type 1 (HSV-1) infection of neurons at the single-cell level. We used micrometer-scale Matrigel beads, termed microgels, to culture individual murine superior cervical ganglia (SCG) neurons or epithelial cells. Microgel-cultured cells are encapsulated in individual media-in-oil droplets with a dual-fluorescent reporter HSV-1, enabling real-time observation of viral gene expression and replication. Infection within drops revealed that the kinetics of initial viral gene expression and replication were dependent on the inoculating dose. Notably, increasing inoculating doses led to earlier onset of viral gene expression and more frequent productive viral replication. These observations provide crucial insights into the complexity of HSV-1 infection in neurons and emphasize the importance of studying single-cell outcomes of viral infection. These techniques for cell culture and infection in drops provide a foundation for future virology and neurobiology investigations.

PRDX6
Also flagged:mitochondrialamino acidlipidbiosynthesismetabolismgene expression
Journal Article 2024-02-28 ✓ 1 Snippet Choudhury FK, Premkumar V, Zecha J, Boyd J, Gaynor AS, Guo Z, Martin T, Cimbro R, Allman EL, Hess S.
In-Text Gene Mentions

…and redox metabolism (PRDX6, ABCB7, TMX1; Supplementary…

Show Full Abstract

Fluorescence-activated cell sorting (FACS) is a specialized technique to isolate specific cell subpopulations with a high level of recovery and accuracy. However, the cell sorting procedure can impact the viability and metabolic state of cells. Here, we performed a comparative study and evaluated the impact of traditional high-pressure charged droplet-based and microfluidic chip-based sorting on the metabolic and phosphoproteomic profile of different cell types. While microfluidic chip-based sorted cells more closely resembled the unsorted control group for most cell types tested, the droplet-based sorted cells showed significant metabolic and phosphoproteomic alterations. In particular, greater changes in redox and energy status were present in cells sorted with the droplet-based cell sorter along with larger shifts in proteostasis. <sup>13</sup>C-isotope tracing analysis on cells recovering postsorting revealed that the sorter-induced suppression of mitochondrial TCA cycle activity recovered faster in the microfluidic chip-based sorted group. Apart from this, amino acid and lipid biosynthesis pathways were suppressed in sorted cells, with minimum impact and faster recovery in the microfluidic chip-based sorted group. These results indicate microfluidic chip-based sorting has a minimum impact on metabolism and is less disruptive compared to droplet-based sorting.

Also flagged:sotalolatrial arrhythmiascreatinineatrial arrhythmiaatrial fibrillationAF
Journal Article 2024-02-28 No Snippets Steinberg BA, Holubkov R, Deering T, Groh CA, Mittal S, Kennedy R, Pokharel P, Perez M, Savona S, Verma N, Watt K, Piccini JP, Bunch TJ.
Show Full Abstract

<h4>Background</h4>Loading of oral sotalol for atrial fibrillation requires 3 days, frequently in the hospital, to achieve steady state. The Food and Drug Administration approved loading with intravenous (IV) sotalol through model-informed development, without patient data.<h4>Objective</h4>We present results of the first multicenter evaluation of this recent labeling for IV sotalol.<h4>Methods</h4>The Prospective Evaluation Analysis and Kinetics of IV Sotalol (PEAKS) Registry was a multicenter observational registry of patients undergoing elective IV sotalol load for atrial arrhythmias. Outcomes, measured from hospital admission until first outpatient follow-up, included adverse arrhythmia events, efficacy, and length of stay.<h4>Results</h4>Of 167 consecutively enrolled patients, 23% were female; the median age was 68 (interquartile range, 61-74) years, and the median CHA<sub>2</sub>DS<sub>2</sub>-VASc score was 3 (interquartile range, 2-4). Overall, 99% were admitted for sotalol initiation (1% for dose escalation), with a target oral sotalol dose of either 80 mg twice daily (85 [51%]) or 120 mg twice daily (78 [47%]); 62 patients (37%) had an estimated creatinine clearance ≤90 mL/min. On presentation, 40% of patients were in sinus rhythm, whereas 26% underwent cardioversion before sotalol infusion. In 2 patients, sotalol infusion was stopped for bradycardia or hypotension. In 6 patients, sotalol was discontinued before discharge because of QTc prolongation (3), bradycardia (1), or recurrent atrial arrhythmia (2). The mean length of stay was 1.1 days, and 95% (n = 159) were discharged within 1 night.<h4>Conclusion</h4>IV sotalol loading is safe and feasible for atrial arrhythmias, with low rates of adverse events, and yields shorter hospitalizations. More data are needed on the minimal duration required for monitoring in the hospital.

HTT
Also flagged:Huntingtinneurodegenerative diseasesHuntington's diseaseHDtauopathiespolyglutamine
Journal Article 2024-02-28 ✓ 5 Snippets Pérez-Oliveira S, Castilla-Silgado J, Painous C, Aldecoa I, Menéndez-González M, Blázquez-Estrada M, Corte D, Tomás-Zapico C, Compta Y, Muñoz E, Lladó A, Balasa M, Aragonès G, García-González P, Rosende-Roca M, Boada M, Ruíz A, Pastor P, De la Casa-Fages B, Rabano A, Sánchez-Valle R, Molina-Porcel L, Álvarez V.
In-Text Gene Mentions

We genotyped the HTT gene CAG repeat number and APOE‐E isoforms in a cohort of patients with neuropathological diagnoses of tauopathies (n=588), including 34 corticobasal degeneration (CBD), 98 progressive supranuclear palsy (PSP) and 456 Alzheimer's disease (AD).

Huntington's disease (HD) is an inherited neurodegenerative disease linked to a CAG repeat expansion at the Huntingtin gene (HTT; MIM:613004).

Recently, a link between the CAG repeats in the HTT gene and frontotemporal dementia/amyotrophic lateral sclero (FTD/ALS) phenotypes has been proposed [11].

First, the mutant HTT protein alters tau splicing, phosphorylation, oligomerization and subcellular localization [6, 7]; second, patients with HD present aggregated tau inclusions within various structures of the brain, including those with young‐onset [8, 9] and, third, the MAPT H2 haplotype influences the cognitive function of HD patients [9, 10].

Next, we studied whether patients with tauopathies and pathological expansions of HTT had a differential distribution pattern based on the subtype of tauopathy.

Show Full Abstract

Previous studies have suggested a relationship between the number of CAG triplet repeats in the HTT gene and neurodegenerative diseases not related to Huntington's disease (HD). This study seeks to investigate whether the number of CAG repeats of HTT is associated with the risk of developing certain tauopathies and its influence as a modulator of the clinical and neuropathological phenotype. Additionally, it aims to evaluate the potential of polyglutamine staining as a neuropathological screening. We genotyped the HTT gene CAG repeat number and APOE-ℰ isoforms in a cohort of patients with neuropathological diagnoses of tauopathies (n=588), including 34 corticobasal degeneration (CBD), 98 progressive supranuclear palsy (PSP) and 456 Alzheimer's disease (AD). Furthermore, we genotyped a control group of 1070 patients, of whom 44 were neuropathologic controls. We identified significant differences in the number of patients with pathological HTT expansions in the CBD group (2.7%) and PSP group (3.2%) compared to control subjects (0.2%). A significant increase in the size of the HTT CAG repeats was found in the AD compared to the control group, influenced by the presence of the Apoliprotein E (APOE)-ℰ4 isoform. Post-mortem assessments uncovered tauopathy pathology with positive polyglutamine aggregates, with a slight predominance in the neostriatum for PSP and CBD cases and somewhat greater limbic involvement in the AD case. Our results indicated a link between HTT CAG repeat expansion with other non-HD pathology, suggesting they could share common neurodegenerative pathways. These findings support that genetic or histological screening for HTT repeat expansions should be considered in tauopathies.

Also flagged:sleep-disordered breathinghypertensionupper airway obstructionpregnanoloneprogesteronesleep
Journal Article 2024-02-28 No Snippets Zhang Y, Zhang Y, Yu B, Qi Q, Azarbarzin A, Chen H, Shah NA, Ramos AR, Zee PC, Cai J, Daviglus ML, Boerwinkle E, Kaplan R, Liu PY, Redline S, Sofer T.
Show Full Abstract

Sleep-disordered breathing (SDB) is a prevalent disorder characterized by recurrent episodic upper airway obstruction. Using data from the Hispanic Community Health Study/Study of Latinos (HCHS/SOL), we apply principal component analysis (PCA) to seven SDB-related measures. We estimate the associations of the top two SDB PCs with serum levels of 617 metabolites, in both single-metabolite analysis, and a joint penalized regression analysis. The discovery analysis includes 3299 individuals, with validation in a separate dataset of 1522 individuals. Five metabolite associations with SDB PCs are discovered and replicated. SDB PC1, characterized by frequent respiratory events common in older and male adults, is associated with pregnanolone and progesterone-related sulfated metabolites. SDB PC2, characterized by short respiratory event length and self-reported restless sleep, enriched in young adults, is associated with sphingomyelins. Metabolite risk scores (MRSs), representing metabolite signatures associated with the two SDB PCs, are associated with 6-year incident hypertension and diabetes. These MRSs have the potential to serve as biomarkers for SDB, guiding risk stratification and treatment decisions.

POU3F2
Also flagged:CREB5Glioblastoma multiformeGBMbrain cancerGliomatumor
Journal Article 2024-02-28 ✓ 2 Snippets Kim HJ, Jeon HM, Batara DC, Lee S, Lee SJ, Yin J, Park SI, Park M, Seo JB, Hwang J, Oh YJ, Suh SS, Kim SH.
In-Text Gene Mentions

We then hypothesize the role CREB5-OLIG2 axis in GSCs as follows: 1) as a central nervous system (CNS) restricted transcription factor, it plays an essential role in glial progenitor proliferation [18–20]; (2) it is widely expressed in gliomas and plays a critical role in gliomagenesis and tumor phenotype plasticity; and [15–17, 21–23] (3) recently, OLIG2 has been identified as a core transcription factor, along with SOX2, SALL2, and POU3F2, that reprograms differentiated GBM cells into GSCs [14].

…SOX2, SALL2, andPOU3F2, that reprograms differentiat…

Show Full Abstract

Glioblastoma multiforme (GBM) is the most fatal form of brain cancer in humans, with a dismal prognosis and a median overall survival rate of less than 15 months upon diagnosis. Glioma stem cells (GSCs), have recently been identified as key contributors in both tumor initiation and therapeutic resistance in GBM. Both public dataset analysis and direct differentiation experiments on GSCs have demonstrated that CREB5 is more highly expressed in undifferentiated GSCs than in differentiated GSCs. Additionally, gene silencing by short hairpin RNA (shRNA) of CREB5 has prevented the proliferation and self-renewal ability of GSCs in vitro and decreased their tumor forming ability in vivo. Meanwhile, RNA-sequencing, luciferase reporter assay, and ChIP assay have all demonstrated the closely association between CREB5 and OLIG2. These findings suggest that targeting CREB5 could be an effective approach to overcoming GSCs.

Also flagged:mineralsmineralexcretionsulfatehydroxychloridecopper
Journal Article 2024-02-28 No Snippets Aparecida Martins R, de Almeida Assunção AS, Cavalcante Souza Vieira J, Campos Rocha L, Michelin Groff Urayama P, Afonso Rabelo Buzalaf M, Roberto Sartori J, de Magalhães Padilha P.
Show Full Abstract

Supplementing minerals beyond dietary requirements can increase the risk of toxicity and mineral excretion, making the selection of more bioavailable sources crucial. Thus, this work aimed to use metalloproteomics tools to investigate possible alterations in the hepatic proteome of broilers fed with diets containing two sources (sulfate and hydroxychloride) and two levels of copper (15 and 150 ppm) and manganese (80 and 120 ppm), totaling four treatments: low Cu/Mn SO<sub>4</sub>, high Cu/Mn SO<sub>4</sub>, low Cu/Mn (OH)Cl and high Cu/Mn (OH)Cl. The difference in abundance of protein spots and copper and manganese concentrations in liver and protein pellets were analyzed by analysis of variance with significance level of 5%. The Cu and Mn concentrations determined in liver and protein pellets suggested greater bioavailability of hydroxychloride sources. We identified 19 Cu-associated proteins spots, 10 Mn-associated protein spots, and 5 Cu and/or Mn-associated protein spots simultaneously. The analysis also indicated the induction of heat shock proteins and detoxification proteins in broilers fed with high levels of copper and manganese, suggesting the involvement of these proteins in metal tolerance and stress.

PRDX6
Also flagged:lactatemetabolismskin inflammationHIF-1αNF-κBpsoriatic skin disorder
Journal Article 2024-02-28 ✓ 1 Snippet Ayyangar U, Karkhanis A, Tay H, Afandi AFB, Bhattacharjee O, Ks L, Lee SH, Chan J, Raghavan S.
In-Text Gene Mentions

…Nqo1 , andPrdx6in E18.5 cKO…

Show Full Abstract

Dysregulated macrophage responses and changes in tissue metabolism are hallmarks of chronic inflammation in the skin. However, the metabolic cues that direct and support macrophage functions in the skin are poorly understood. Here, we show that during sterile skin inflammation, the epidermis and macrophages uniquely depend on glycolysis and the TCA cycle, respectively. This compartmentalisation is initiated by ROS-induced HIF-1α stabilization leading to enhanced glycolysis in the epidermis. The end-product of glycolysis, lactate, is then exported by epithelial cells and utilized by the dermal macrophages to induce their M2-like fates through NF-κB pathway activation. In addition, we show that psoriatic skin disorder is also driven by such lactate metabolite-mediated crosstalk between the epidermis and macrophages. Notably, small-molecule inhibitors of lactate transport in this setting attenuate sterile inflammation and psoriasis disease burden, and suppress M2-like fate acquisition in dermal macrophages. Our study identifies an essential role for the metabolite lactate in regulating macrophage responses to inflammation, which may be effectively targeted to treat inflammatory skin disorders such as psoriasis.

HFE
Also flagged:ironiron deficiencyerythropoiesisanemiaoxygenHepcidin
Journal Article 2024-02-28 ✓ 5 Snippets Ledesma-Colunga MG, Passin V, Vujic Spasic M, Hofbauer LC, Baschant U, Rauner M.
In-Text Gene Mentions

However, the impact of Hfe deficiency on bone status remains a topic of debate11,12, and the effect of Hjv mutation has yet to be determined.

…the impact ofHfedeficiency on bone…

…dependent on thehemochromatosismutation/type, duration and…

…mRNA expression ofHfe, Slc40a1 ,…

…genes such asHfe, Tfr1 ,…

Show Full Abstract

Iron is an essential nutrient for all living organisms. Both iron deficiency and excess can be harmful. Bone, a highly metabolic active organ, is particularly sensitive to fluctuations in iron levels. In this study, we investigated the effects of dietary iron overload on bone homeostasis with a specific focus on two frequently utilized mouse strains: 129/Sv and C57BL/6J. Our findings revealed that after 6 weeks on an iron-rich diet, 129/Sv mice exhibited a decrease in trabecular and cortical bone density in both vertebral and femoral bones, which was linked to reduced bone turnover. In contrast, there was no evidence of bone changes associated with iron overload in age-matched C57BL/6J mice. Interestingly, 129/Sv mice exposed to an iron-rich diet during their prenatal development were protected from iron-induced bone loss, suggesting the presence of potential adaptive mechanisms. Overall, our study underscores the critical role of genetic background in modulating the effects of iron overload on bone health. This should be considered when studying effects of iron on bone.

Also flagged:SOX17tumourscolorectal cancerschromatintumourIFNγ
Journal Article 2024-02-28 No Snippets Goto N, Westcott PMK, Goto S, Imada S, Taylor MS, Eng G, Braverman J, Deshpande V, Jacks T, Agudo J, Yilmaz ÖH.
Show Full Abstract

A hallmark of cancer is the avoidance of immune destruction. This process has been primarily investigated in locally advanced or metastatic cancer<sup>1-3</sup>; however, much less is known about how pre-malignant or early invasive tumours evade immune detection. Here, to understand this process in early colorectal cancers (CRCs), we investigated how naive colon cancer organoids that were engineered in vitro to harbour Apc-null, Kras<sup>G12D</sup> and Trp53-null (AKP) mutations adapted to the in vivo native colonic environment. Comprehensive transcriptomic and chromatin analyses revealed that the endoderm-specifying transcription factor SOX17 became strongly upregulated in vivo. Notably, whereas SOX17 loss did not affect AKP organoid propagation in vitro, its loss markedly reduced the ability of AKP tumours to persist in vivo. The small fraction of SOX17-null tumours that grew displayed notable interferon-γ (IFNγ)-producing effector-like CD8<sup>+</sup> T cell infiltrates in contrast to the immune-suppressive microenvironment in wild-type counterparts. Mechanistically, in both endogenous Apc-null pre-malignant adenomas and transplanted organoid-derived AKP CRCs, SOX17 suppresses the ability of tumour cells to sense and respond to IFNγ, preventing anti-tumour T cell responses. Finally, SOX17 engages a fetal intestinal programme that drives differentiation away from LGR5<sup>+</sup> tumour cells to produce immune-evasive LGR5<sup>-</sup> tumour cells with lower expression of major histocompatibility complex class I (MHC-I). We propose that SOX17 is a transcription factor that is engaged during the early steps of colon cancer to orchestrate an immune-evasive programme that permits CRC initiation and progression.

DNAH10
Also flagged:PPARperoxisome proliferator-activated receptormetabolismenergy homeostasisimmune responsehepatocellular carcinoma
Journal Article 2024-02-28 ✓ 1 Snippet Shi Q, Zeng Y, Xue C, Chu Q, Yuan X, Li L.
In-Text Gene Mentions

…RB1, DOCK2, SPEG,DNAH10and TG were…

Show Full Abstract

The peroxisome proliferator-activated receptor (PPAR) signaling pathway plays a crucial role in systemic cell metabolism, energy homeostasis and immune response inhibition. However, its significance in hepatocellular carcinoma (HCC) has not been well documented. In our study, based on the RNA sequencing data of HCC, consensus clustering analyses were performed to identify PPAR signaling pathway-related molecular subtypes, each of which displaying varying survival probabilities and immune infiltration status. Following, a prognostic prediction model of HCC was developed by using the random survival forest method and Cox regression analysis. Significant difference in survival outcome, immune landscape, drug sensitivity and pathological features were observed between patients with different prognosis. Additionally, decision tree and nomogram models were adopted to optimize the prognostic prediction model. Furthermore, the robustness of the model was verified through single-cell RNA-sequencing data. Collectively, this study systematically elucidated that the PPAR signaling pathway-related prognostic model has good predictive efficacy for patients with HCC. These findings provide valuable insights for further research on personalized treatment approaches for HCC.

HTT
Also flagged:SLC7A2solute carrier family 7 member 2HuntingtinArginineinflammatory responsesadaptive immunity
Journal Article 2024-02-28 ✓ 5 Snippets Gaudet ID, Xu H, Gordon E, Cannestro GA, Lu ML, Wei J.
In-Text Gene Mentions

We recently reported that SLC7A2 transcripts were significantly upregulated (> 15-fold increase) in human neuroblastoma SH-SY5Y cells when normal HTT was knocked out using the CRISPR–Cas9 system [6], suggesting that normal HTT may functionally repress SLC7A2 transcription and that this function could be potentially affected by muHTT.

Although the genetic mutation of HD, i.e., the abnormal expansion of CAG repeats in the huntingtin gene (HTT), was identified almost 30 years ago [1], the molecular pathogenesis of HD remains elusive.

In Drosophila and zebrafish models of HD, nitrosative stress inhibited autophagosome formation through aberrant nitrosylation of JNK1 (c-Jun N-terminal protein kinase 1) and IKKβ (IkappaB kinase beta), while inhibition of NOS activity promoted autophagy and reduced mutant HTT aggregation and neurodegeneration [67].

…huntingtin gene (HTT), was identified…

HTTis a multifunctional…

Show Full Abstract

We previously identified solute carrier family 7 member 2 (SLC7A2) as one of the top upregulated genes when normal Huntingtin was deleted. SLC7A2 has a high affinity for L-arginine. Arginine is implicated in inflammatory responses, and SLC7A2 is an important regulator of innate and adaptive immunity in macrophages. Although neuroinflammation is clearly demonstrated in animal models and patients with Huntington's disease (HD), the question of whether neuroinflammation actively participates in HD pathogenesis is a topic of ongoing research and debate. Here, we studied the role of SLC7A2 in mediating the neuroinflammatory stress response in HD cells. RNA sequencing (RNA-seq), quantitative RT-PCR and data mining of publicly available RNA-seq datasets of human patients were performed to assess the levels of SLC7A2 mRNA in different HD cellular models and patients. Biochemical studies were then conducted on cell lines and primary mouse astrocytes to investigate arginine metabolism and nitrosative stress in response to neuroinflammation. The CRISPR-Cas9 system was used to knock out SLC7A2 in STHdhQ7 and Q111 cells to investigate its role in mediating the neuroinflammatory response. Live-cell imaging was used to measure mitochondrial dynamics. Finally, exploratory studies were performed using the Enroll-HD periodic human patient dataset to analyze the effect of arginine supplements on HD progression. We found that SLC7A2 is selectively upregulated in HD cellular models and patients. HD cells exhibit an overactive response to neuroinflammatory challenges, as demonstrated by abnormally high iNOS induction and NO production, leading to increased protein nitrosylation. Depleting extracellular Arg or knocking out SLC7A2 blocked iNOS induction and NO production in STHdhQ111 cells. We further examined the functional impact of protein nitrosylation on a well-documented protein target, DRP-1, and found that more mitochondria were fragmented in challenged STHdhQ111 cells. Last, analysis of Enroll-HD datasets suggested that HD patients taking arginine supplements progressed more rapidly than others. Our data suggest a novel pathway that links arginine uptake to nitrosative stress via upregulation of SLC7A2 in the pathogenesis and progression of HD. This further implies that arginine supplements may potentially pose a greater risk to HD patients.

DCC
Also flagged:cancermelanomatumorDormant cancerscancerscutaneous melanoma
Journal Article 2024-02-28 ✓ 1 Snippet Singvogel K, Schittek B.
In-Text Gene Mentions

The life cycle of a cancer cell – including transitions from circulating DCC to the growth-arrested cancer cell in the distinct niches up to the escape from the dormant state - requires a high plasticity of the cells, which is influenced by niche components [62].

Show Full Abstract

Many cancer-related deaths including melanoma result from metastases that develop months or years after the initial cancer therapy. Even the most effective drugs and immune therapies rarely eradicate all tumor cells. Instead, they strongly reduce cancer burden, permitting dormant cancer cells to persist in niches, where they establish a cellular homeostasis with their host without causing clinical symptoms. Dormant cancers respond poorly to most drugs and therapies since they do not proliferate and hide in niches. It therefore remains a major challenge to develop novel therapies for dormant cancers. In this review we focus on the mechanisms regulating the initiation of cutaneous melanoma dormancy as well as those which are involved in reawakening of dormant cutaneous melanoma cells. In recent years the role of neutrophils and niche components in reawakening of melanoma cells came into focus and indicate possible future therapeutic applications. Sophisticated in vitro and in vivo melanoma dormancy models are needed to make progress in this field and are discussed.

Also flagged:methyltransferaseVP39bindingNSC 319990NSC 196515NSC 376254
Journal Article 2024-02-28 No Snippets Thai QM, Phung HTT, Pham NQA, Horng JT, Tran PT, Tung NT, Ngo ST.
Show Full Abstract

VP39, an essential 2'-O-RNA methyltransferase enzyme discovered in Monkeypox virus (MPXV), plays a vital role in viral RNA replication and transcription. Inhibition of the enzyme may prevent viral replication. In this context, using a combination of molecular docking and molecular dynamics (MDs) simulations, the inhibitory ability of NCI Diversity Set VII natural compounds to VP39 protein was investigated. It should be noted that the computed binding free energy of ligand <i>via</i> molecular docking and linear interaction energy (LIE) approaches are in good agreement with the corresponding experiments with coefficients of R=0.72 and 0.75, respectively. NSC 319990, NSC 196515 and NSC 376254 compounds were demonstrated that can inhibit MPVX methyltransferase VP39 protein with the similar affinity compared to available inhibitor sinefungin. Moreover, nine residues involving <i>Gln39</i>, <i>Gly68</i>, <i>Gly72</i>, <i>Asp95</i>, <i>Arg97</i>, <i>Val116</i>, <i>Asp138</i>, <i>Arg140</i> and <i>Asn156</i> may be argued that they play an important role in binding process of inhibitors to VP39.

CA10
Also flagged:AgingGene Expressionage-related cognitive declineneurological diseasescognitive impairmentmethylation
Journal Article 2024-02-28 ✓ 4 Snippets Zarrella JA, Tsurumi A.
In-Text Gene Mentions

…Carbonic Anhydrase 10 (CA10), Cell Division Cycle…

…( ASPHD2, BAD,CA10, CDC42, GPR26, NECTIN3,…

CA10, encoding a…

…the importance ofCA10transcript in age…

Show Full Abstract

Aging-related transcriptome changes in various regions of the healthy human brain have been explored in previous works, however, a study to develop prediction models for age based on the expression levels of specific panels of transcripts is lacking. Moreover, studies that have assessed sexually dimorphic gene activities in the aging brain have reported discrepant results, suggesting that additional studies would be advantageous. The prefrontal cortex (PFC) region was previously shown to have a particularly large number of significant transcriptome alterations during healthy aging in a study that compared different regions in the human brain. We harmonized neuropathologically normal PFC transcriptome datasets obtained from the Gene Expression Omnibus (GEO) repository, ranging in age from 21 to 105 years, and found a large number of differentially regulated transcripts in the old and elderly, compared to young samples overall, and compared female and male-specific expression alterations. We assessed the genes that were associated with age by employing ontology, pathway, and network analyses. Furthermore, we applied various established (least absolute shrinkage and selection operator (Lasso) and Elastic Net (EN)) and recent (eXtreme Gradient Boosting (XGBoost) and Light Gradient Boosting Machine (LightGBM)) machine learning algorithms to develop accurate prediction models for chronological age and validated them. Studies to further validate these models in other large populations and molecular studies to elucidate the potential mechanisms by which the transcripts identified may be related to aging phenotypes would be advantageous.

Also flagged:topiramatephenylephrineacetylcholinesodiumnitroprussideendothelial nitric oxide synthase
Journal Article 2024-02-28 No Snippets Moura KF, Silva DGD, Vidigal CB, Silva GSSE, Pinto IC, Simão ANC, Marques BVD, Andrade FG, Casagrande R, Gerardin DCC, Akamine EH, Franco MDCP, Ceravolo GS.
Show Full Abstract

<h4>Aim</h4>The present study evaluated whether topiramate (TPM) treatment during the peripubertal period affects vascular parameters of male rats and whether oxidative stress plays a role in these changes.<h4>Main methods</h4>Rats were treated with TPM (41 mg/kg/day, gavage) or vehicle (CTR group) from the postnatal day (PND) 28 to 50. At PND 51 and 120 the rats were evaluated for: thoracic aorta reactivity to phenylephrine, in the presence (Endo+) or absence of endothelium (Endo-), to acetylcholine and to sodium nitroprusside (SNP), aortic thickness and endothelial nitric oxide synthase (eNOS) expression. In serum were analyzed: the antioxidant capacity by ferric reducing antioxidant power assay; endogenous antioxidant reduced glutathione, and superoxide anion. Results were expressed as mean ± s.e.m., differences when p < 0.05.<h4>Statistics</h4>Two-way ANOVA (and Tukey's) or Student t-test.<h4>Key findings</h4>At PND 51, the contraction induced by phenylephrine in Endo+ ring was higher in TPM when compared to CTR. At PND 120, the aortic sensitivity to acetylcholine in TPM rats was reduced in comparison with CTR. The aortic eNOs expression and the aortic thickness were similar between the groups. At PND 51 and 120, TPM group presented a decrease in antioxidants when compared to CTR groups and at PND 120, in TPM group the superoxide anion was increased.<h4>Significance</h4>Taken together, the treatment of rats with TPM during peripubertal period promoted permanent impairment of endothelial function probably mediated by oxidative stress.

HFE
Also flagged:Type 2 Diabetes Mellitustype 2 diabetesmacroangiopathyarteriosclerosis obliteransarteriosclerosis occlusiongene expression
Journal Article 2024-02-28 ✓ 1 Snippet Zeng G, Jin YZ, Huang Y, Hu JS, Li MF, Tian M, Lu J, Huang R.
In-Text Gene Mentions

…Syndrome or immunocompromised,hemochromatosis, diagnosed with cancers,…

Show Full Abstract

<h4>Background</h4>The pathological damage mechanism of type 2 diabetes (T2D) and macroangiopathy is extremely complex, and T2D and arteriosclerosis obliterans have different biological behaviors and clinical features. To explore the mechanism of lower extremity arteriosclerosis occlusion (LEAOD) in T2D patients, we utilized RNA-seq to identify unique gene expression signatures of T2D and LEAOD through transcriptomic analysis.<h4>Methods</h4>We obtained blood samples and performed RNA sequencing from four patients with T2D, five of whom had LEAOD. Another six age- and gender-matched blood samples from healthy volunteers were used for control. By exploring the general and specific differential expression analysis after transcriptome sequencing, specific gene expression patterns of T2D and LEAOD were verified.<h4>Results</h4>Transcriptome analysis found differentially expressed genes in T2D, and T2D + LEAOD (vs normal) separately, of which 35/486 (T2D/T2D + LEAOD) were up-regulated and 1290/2970 (T2D/T2D + LEAOD) were down-regulated. A strong overlap of 571 genes across T2D, LEAOD, and coexisting conditions was mainly involved in extracellular exosomes and the transcription process. By exploring the sex difference gene expression features between T2D, T2D + LEAOD, and healthy controls, we noticed that sex chromosome-associated genes do not participate in the sexual dimorphism gene expression profiles of T2D and LEAOD. Protein-Protein Interaction Network analysis and drug target prediction provided the drug candidates to treat T2D and LEAOD.<h4>Conclusion</h4>This study provides some evidence at the transcript level to uncover the association of T2D with LEAOD. The screened hub genes and predicted target drugs may be therapeutic targets.

PRDX6
Also flagged:Orosomucoid 2atherosclerosisoxygenlipidOrosomucoidcarotid atherosclerosis
Journal Article 2024-02-28 ✓ 4 Snippets Che Y, Ren J, Zhao H, Yang Y, Chen Z.
In-Text Gene Mentions

The expressions of ORM2 and PRDX-6 were correlated, and MJ33 (an inhibitor of PRDX6-PLA2) decreased ROS production and lipid accumulation in VSMCs.<h4>Conclusion</h4>ORM2 may be a biomarker for CAS; it induced lipid accumulation and ROS production in VSMCs during atherosclerosis plaque formation.

Oleic acid increased the lipid accumulation and ORM2 and PRDX6 expressions in the VSMCs.

…and ORM2 andPRDX6expressions in the…

…(an inhibitor ofPRDX6-PLA2) decreased ROS productio…

Show Full Abstract

<h4>Background</h4>Orosomucoid (ORM) has been reported as a biomarker of carotid atherosclerosis, but the role of ORM 2, a subtype of ORM, in carotid atherosclerotic plaque formation and the underlying mechanism have not been established.<h4>Methods</h4>Plasma was collected from patients with carotid artery stenosis (CAS) and healthy participants and assessed using mass spectrometry coupled with isobaric tags for relative and absolute quantification (iTRAQ) technology to identify differentially expressed proteins. The key proteins and related pathways were identified via western blotting, immunohistochemistry, and polymerase chain reaction of carotid artery plaque tissues and in vitro experiments involving vascular smooth muscle cells (VSMCs).<h4>Results</h4>We screened 33 differentially expressed proteins out of 535 proteins in the plasma. Seventeen proteins showed increased expressions in the CAS groups relative to the healthy groups, while 16 proteins showed decreased expressions during iTRAQ and bioinformatic analysis. The reactive oxygen species metabolic process was the most common enrichment pathway identified by Gene Ontology analysis, while ORM2, PRDX2, GPX3, HP, HBB, ANXA5, PFN1, CFL1, and S100A11 were key proteins identified by STRING and MCODE analysis. ORM2 showed increased expression in patients with CAS plaques, and ORM2 was accumulated in smooth muscle cells. Oleic acid increased the lipid accumulation and ORM2 and PRDX6 expressions in the VSMCs. The recombinant-ORM2 also increased the lipid accumulation and reactive oxygen species (ROS) in the VSMCs. The expressions of ORM2 and PRDX-6 were correlated, and MJ33 (an inhibitor of PRDX6-PLA2) decreased ROS production and lipid accumulation in VSMCs.<h4>Conclusion</h4>ORM2 may be a biomarker for CAS; it induced lipid accumulation and ROS production in VSMCs during atherosclerosis plaque formation. However, the relationships between ORM2 and PRDX-6 underlying lipid accumulation-induced plaque vulnerability require further research.

HTT
Also flagged:inflammatory responseinfectionchemokinesoxygenneurologic diseaseinflammatory responses
Journal Article 2024-02-28 ✓ 3 Snippets Chen Y, Mateski J, Gerace L, Wheeler J, Burl J, Prakash B, Svedin C, Amrick R, Adams BD.
In-Text Gene Mentions

Huntington’s disease is a rare neurodegenerative disorder caused by an autosomal dominantly-inherited CAG-trinucleotide repeat-expansion encoding for glutamine in the huntingtin (HTT) gene, leading to protein misfolding and aggregation of aberrant proteins [153, 155, 197].

…the huntingtin (HTT) gene, leading…

…repeats in theHTTgene, the most…

Show Full Abstract

Neuroinflammation is considered a balanced inflammatory response important in the intrinsic repair process after injury or infection. Under chronic states of disease, injury, or infection, persistent neuroinflammation results in a heightened presence of cytokines, chemokines, and reactive oxygen species that result in tissue damage. In the CNS, the surrounding microglia normally contain macrophages and other innate immune cells that perform active immune surveillance. The resulting cytokines produced by these macrophages affect the growth, development, and responsiveness of the microglia present in both white and gray matter regions of the CNS. Controlling the levels of these cytokines ultimately improves neurocognitive function and results in the repair of lesions associated with neurologic disease. MicroRNAs (miRNAs) are master regulators of the genome and subsequently control the activity of inflammatory responses crucial in sustaining a robust and acute immunological response towards an acute infection while dampening pathways that result in heightened levels of cytokines and chemokines associated with chronic neuroinflammation. Numerous reports have directly implicated miRNAs in controlling the abundance and activity of interleukins, TGF-B, NF-kB, and toll-like receptor-signaling intrinsically linked with the development of neurological disorders such as Parkinson's, ALS, epilepsy, Alzheimer's, and neuromuscular degeneration. This review is focused on discussing the role miRNAs play in regulating or initiating these chronic neurological states, many of which maintain the level and/or activity of neuron-specific secondary messengers. Dysregulated miRNAs present in the microglia, astrocytes, oligodendrocytes, and epididymal cells, contribute to an overall glial-specific inflammatory niche that impacts the activity of neuronal conductivity, signaling action potentials, neurotransmitter robustness, neuron-neuron specific communication, and neuron-muscular connections. Understanding which miRNAs regulate microglial activation is a crucial step forward in developing non-coding RNA-based therapeutics to treat and potentially correct the behavioral and cognitive deficits typically found in patients suffering from chronic neuroinflammation.

OLFM4
Also flagged:ironinnate immunityGene Expressionneutrophil activationneutrophil degranulationimmune response
Journal Article 2024-02-28 ✓ 1 Snippet Feng Z, Fan Y, Shi X, Luo X, Xie J, Liu S, Duan C, Wang Q, Ye Y, Yin W.
In-Text Gene Mentions

…(LTF), Olfactomedin 4 (OLFM4), Resistin (RETN), and…

Show Full Abstract

<h4>Objective</h4>The early targeted and effective diagnosis and treatment of severe trauma are crucial for patients' outcomes. Blood leukocytes act as significant effectors during the initial inflammation and activation of innate immunity in trauma. This study aims to identify hub genes related to patients' prognosis in blood leukocytes at the early stages of trauma.<h4>Methods</h4>The expression profiles of Gene Expression Omnibus (GEO) Series (GSE) 36809 and GSE11375 were downloaded from the GEO database. R software, GraphPad Prism 9.3.1 software, STRING database, and Cytoscape software were used to process the data and identify hub genes in blood leukocytes of early trauma.<h4>Results</h4>Gene Ontology (GO) analysis showed that the differentially expressed genes (DEGs) of blood leukocytes at the early stages of trauma (0-4 h, 4-8 h, and 8-12 h) were mainly involved in neutrophil activation and neutrophil degranulation, neutrophil activation involved in immune response, neutrophil mediated immunity, lymphocyte differentiation, and cell killing. Kyoto Encyclopedia of Genes and Genomes (KEGG) analysis showed that the DEGs were mainly involved in Osteoclast differentiation and Hematopoietic cell lineage. Sixty-six down-regulated DEGs and 148 up-regulated DEGs were identified and 37 hub genes were confirmed by Molecular Complex Detection (MCODE) of Cytoscape. Among the hub genes, Lipocalin 2 (LCN2), Lactotransferrin (LTF), Olfactomedin 4 (OLFM4), Resistin (RETN), and Transcobalamin 1 (TCN1) were related to prognosis and connected with iron transport closely. LCN2 and LTF were involved in iron transport and had a moderate predictive value for the poor prognosis of trauma patients, and the AUC of LCN2 and LTF was 0.7777 and 0.7843, respectively.<h4>Conclusion</h4>As iron transport-related hub genes in blood leukocytes, LCN2 and LTF can be used for prognostic prediction of early trauma.

Also flagged:PorousFluorideHydroxyapatitemineralfluoride ionsfluorapatite
Journal Article 2024-02-28 No Snippets Ratnayake J, Gould M, Ramesh N, Mucalo M, Dias GJ.
Show Full Abstract

Hydroxyapatite is widely used in bone implantation because of its similar mineral composition to natural bone, allowing it to serve as a biocompatible osteoconductive support. A bovine-derived hydroxyapatite (BHA) scaffold was developed through an array of defatting and deproteinization procedures. The BHA scaffold was substituted with fluoride ions using a modified sol-gel method to produce a bovine-derived fluorapatite (BFA) scaffold. Fourier-transform infrared spectroscopy and X-ray diffraction analysis showed that fluoride ions were successfully substituted into the BHA lattice. According to energy dispersive X-ray analysis, the main inorganic phases contained calcium and phosphorus with a fluoride ratio of ~1-2 wt%. Scanning electron microscopy presented a natural microporous architecture for the BFA scaffold with pore sizes ranging from ~200-600 μm. The BHA scaffold was chemically stable and showed sustained degradation in simulated-body fluid. Young's modulus and yield strength were superior in the BFA scaffold to BHA. In vitro cell culture studies showed that the BFA was biocompatible, supporting the proliferative growth of Saos-2 osteoblast cells and exhibiting osteoinductive features. This unique technique of producing hydroxyapatite from bovine bone with the intent of producing high performance biomedically targeted materials could be used to improve bone repair.

PRDX6
Also flagged:MLKLObesityInsulinFructosefatty liver diseaseinflammatory cell
Journal Article 2024-02-28 ✓ 1 Snippet Ohene-Marfo P, Nguyen HVM, Mohammed S, Thadathil N, Tran A, Nicklas EH, Wang D, Selvarani R, Farriester JW, Varshney R, Kinter M, Richardson A, Rudolph MC, Deepa SS.
In-Text Gene Mentions

…5 (PRDX5, 1.5-fold),PRDX6(1.4-fold), thioredoxin 1…

Show Full Abstract

Chronic inflammation is a key player in metabolic dysfunction-associated fatty liver disease (MAFLD) progression. Necroptosis, an inflammatory cell death pathway, is elevated in MAFLD patients and mouse models, yet its role is unclear due to the diverse mouse models and inhibition strategies. In our study, we inhibited necroptosis by targeting mixed lineage kinase domain-like pseudokinase (MLKL), the terminal effector of necroptosis, in a high-fat, high-fructose, high-cholesterol (HFHFrHC) mouse model of diet-induced MAFLD. Despite the HFHFrHC diet upregulating MLKL (2.5-fold), WT mice livers showed no increase in necroptosis markers or associated proinflammatory cytokines. Surprisingly, <i>Mlkl<sup>-/-</sup></i> mice experienced exacerbated liver inflammation without protection from diet-induced liver damage, steatosis, or fibrosis. In contrast, <i>Mlkl<sup>+/-</sup></i> mice showed a significant reduction in these parameters that was associated with elevated Pparα and Pparγ levels. Both <i>Mlkl<sup>-/-</sup></i> and <i>Mlkl<sup>+/-</sup></i> mice on the HFHFrHC diet resisted diet-induced obesity, attributed to the increased beiging, enhanced oxygen consumption, and energy expenditure due to adipose tissue, and exhibited improved insulin sensitivity. These findings highlight the tissue-specific effects of MLKL on the liver and adipose tissue, and they suggest a dose-dependent effect of MLKL on liver pathology.

HTT
Also flagged:migrainecalcitonin gene related peptideserotoninchronic diseasechronic migraineergotamine tartrate
Journal Article 2024-02-28 ✓ 1 Snippet Frimpong-Manson K, Ortiz YT, McMahon LR, Wilkerson JL.
In-Text Gene Mentions

Also, polymorphism in the serotonin transporter transcription gene (5-HTT gene), which is implicated in anxiety related disorders (Lesch et al., 1996), has been associated with inherited migraine.

Show Full Abstract

The individual and global burden of migraine is of such significance that there are accelerated efforts to develop new therapies. New migraine therapeutics are needed to address the current deficiencies that exist in the efficacy and adherence rate of approved anti-migraine medications. The recent discovery of the calcitonin gene related peptide as an add-on to the role of serotonin has markedly increased the range of new treatment options for acute and chronic migraine. Despite this, tackling the complexity of migraine disorders requires a complete understanding of its pathophysiology. Preclinical animal models can shed light on disease-related pathophysiology, including migraine. Indeed, the use of animal models has been instrumental in developing many therapeutics. However, an animal model is limited by the predictive and face validity of that model, and this extends to preclinical migraine models. In this review, a summary of the current understanding of the pathophysiology of migraine is given from both a preclinical and clinical perspective, and an emphasis is placed on the animal models of migraine. We will discuss the strengths and pitfalls of common preclinical migraine models as well as experimental research areas to explore further.

SUDS3
Also flagged:aginggenetic diseasesmacroautophagyresponse to damagesensingcellular senescence
Journal Article 2024-02-28 ✓ 1 Snippet Milosic F, Hengstschläger M, Osmanagic-Myers S.
In-Text Gene Mentions

…in downregulation ofchromatin modifiermodifier, methyltransferase EZ…

Show Full Abstract

According to current views the major hallmarks of physiological aging may be subdivided into three categories, primary causes of cellular damage (genomic instability, telomere attrition, loss of proteostasis, epigenetic alterations and compromised macroautophagy), antagonistic hallmarks that represent response to damage (deregulated nutrient sensing, cellular senescence, mitochondrial dysfunction) and integrative hallmarks that represent culprits of the phenotype (stem cell exhaustion, altered intercellular communication, chronic inflammation, dysbiosis). In contrast to physiological aging, premature aging diseases are driven by one or two distinct primary causes of aging, such as genomic instability in the case of Werner syndrome (WS), each displaying other hallmarks of aging to a variable extent. In this review we will focus on primary causes of well-investigated premature aging diseases Hutchinson-Gilford progeria syndrome (HGPS), WS, and Cockayne syndrome (CS) and for each provide an overview of reported aging hallmarks to elucidate resemblance to physiological aging on the mechanistic level and in the context of characteristic age-related diseases. Ubiquitous and tissue specific animal models of premature aging diseases will be discussed as useful tools to decipher fundamental aging-related mechanisms and develop intervention strategies to combat premature aging and age-related diseases.

Also flagged:1-methyladenosinetumorbladder cancerBLCAbindingcancer
Journal Article 2024-02-28 No Snippets Yin JJ, Song YL, Guo YF, Dai YH, Chang Q, Wang T, Sun GQ, Lu P, Song DK, Zhang LR.
Show Full Abstract

<b>Introduction:</b> Post-transcriptional RNA modifications are crucial regulators of tumor development and progression. In many biological processes, N<sup>1</sup>-methyladenosine (m<sup>1</sup>A) plays a key role. However, little is known about the links between chemical modifications of messenger RNAs (mRNAs) and long noncoding RNAs (lncRNAs) and their function in bladder cancer (BLCA). <b>Methods:</b> Methylated RNA immunoprecipitation sequencing and RNA sequencing were performed to profile mRNA and lncRNA m<sup>1</sup>A methylation and expression in BLCA cells, with or without stable knockdown of the m<sup>1</sup>A methyltransferase tRNA methyltransferase 61A (TRMT61A). <b>Results:</b> The analysis of differentially methylated gene sites identified 16,941 peaks, 6,698 mRNAs, and 10,243 lncRNAs in the two groups. Gene ontology enrichment and Kyoto Encyclopedia of Genes and Genomes pathway analyses of the differentially methylated and expressed transcripts showed that m<sup>1</sup>A-regulated transcripts were mainly related to protein binding and signaling pathways in cancer. In addition, the differentially genes were identified that were also differentially m<sup>1</sup>A-modified and identified 14 mRNAs and 19 lncRNAs. Next, these mRNAs and lncRNAs were used to construct a lncRNA-microRNA-mRNA competing endogenous RNA network, which included 118 miRNAs, 15 lncRNAs, and 8 mRNAs. Finally, the m<sup>1</sup>A-modified transcripts, SCN2B and ENST00000536140, which are highly expressed in BLCA tissues, were associated with decreased overall patient survival. <b>Discussion:</b> This study revealed substantially different amounts and distributions of m<sup>1</sup>A in BLCA after TRMT61A knockdown and predicted cellular functions in which m<sup>1</sup>A may be involved, providing evidence that implicates m<sup>1</sup>A mRNA and lncRNA epitranscriptomic regulation in BLCA tumorigenesis and progression.

DARS2
Also flagged:cell cycleDnaAbindingDNA bending proteinintegration host factorinitiation
Journal Article 2024-02-28 ✓ 5 Snippets Kasho K, Sakai R, Ito K, Nakagaki W, Satomura R, Jinnouchi T, Ozaki S, Katayama T.
In-Text Gene Mentions

…the chromosomal lociDARS2and datA (…

DARS2catalytically stimulate the…

DARS2contains specific binding…

…study revealed thatDARS2is regulated by…

…feedback regulation ofDARS2is fundamental for…

Show Full Abstract

Timely initiation of chromosomal DNA replication in <i>Escherichia coli</i> is achieved by cell cycle-coordinated regulation of the replication origin, <i>oriC</i>, and the replication initiator, ATP-DnaA. Cellular levels of ATP-DnaA increase and peak at the time for initiation at <i>oriC</i>, after which hydrolysis of DnaA-bound ATP causes those to fall, yielding initiation-inactive ADP-DnaA. This hydrolysis is facilitated by the chromosomal locus <i>datA</i> located downstream of the tRNA-Gly (<i>glyV-X-Y</i>) operon, which possesses a cluster of DnaA-binding sequences and a single binding site (IBS) for the DNA bending protein IHF (integration host factor). While IHF binding activates the <i>datA</i> function and is regulated to occur specifically at post-initiation time, the underlying regulatory mechanisms remain obscure. Here, we demonstrate that <i>datA</i>-IHF binding at pre-initiation time is down-regulated depending on the read-through transcription of <i>datA</i> IBS initiated at the <i>glyV-X-Y</i> promoter. During the cell cycle, the level of read-through transcription, but not promoter activity, fluctuated in a manner inversely related to <i>datA</i>-IHF binding. Transcription from the <i>glyV-X-Y</i> promoter was predominantly interrupted at <i>datA</i> IBS by IHF binding. The terminator/attenuator sequence of the <i>glyV-X-Y</i> operon, as well as DnaA binding within <i>datA</i> overall, contributed to attenuation of transcription upstream of <i>datA</i> IBS, preserving the timely fluctuation of read-through transcription. These findings provide a mechanistic insight of tRNA transcription-dependent <i>datA</i>-IHF regulation, in which an unidentified factor is additionally required for the timely <i>datA</i>-IHF dissociation, and support the significance of <i>datA</i> for controlling the cell cycle progression as a connecting hub of tRNA production and replication initiation.

TAOK3
Also flagged:cancerkinaseKinasespathogenesisreceptor tyrosine kinaseprotein kinase
Journal Article 2024-02-28 ✓ 1 Snippet Zhang Y, Yao L, Chung CR, Huang Y, Li S, Zhang W, Pang Y, Lee TY.
In-Text Gene Mentions

…MAPK3, CDK2, CAMKK2,TAOK3, MAPK1, MAPK5, ERN1,…

Show Full Abstract

Kinases as important enzymes can transfer phosphate groups from high-energy and phosphate-donating molecules to specific substrates and play essential roles in various cellular processes. Existing algorithms for kinase activity from phosphorylated proteomics data are often costly, requiring valuable samples. Moreover, methods to extract kinase activities from bulk RNA sequencing data remain undeveloped. In this study, we propose a computational framework KinPred-RNA to derive kinase activities from bulk RNA-sequencing data in cancer samples. KinPred-RNA framework, using the extreme gradient boosting (XGBoost) regression model, outperforms random forest regression, multiple linear regression, and support vector machine regression models in predicting kinase activities from cancer-related RNA sequencing data. Efficient gene signatures from the LINCS-L1000 dataset were used as inputs for KinPred-RNA. The results highlight its potential to be related to biological function. In conclusion, KinPred RNA constitutes a significant advance in cancer research by potentially facilitating the identification of cancer.

SLC2A14
Also flagged:cardiac diseasespediatric diseasesmTORtuberous sclerosis complexgenetic disordersclerosis
Journal Article 2024-02-28 ✓ 1 Snippet Sidorov VY, Sidorova TN, Samson PC, Reiserer RS, Britt CM, Neely MD, Ess KC, Wikswo JP.
In-Text Gene Mentions

…SLC25A18, SLC22A1, andSLC2A14) between the CC3…

Show Full Abstract

The implementation of three-dimensional tissue engineering concurrently with stem cell technology holds great promise for in vitro research in pharmacology and toxicology and modeling cardiac diseases, particularly for rare genetic and pediatric diseases for which animal models, immortal cell lines, and biopsy samples are unavailable. It also allows for a rapid assessment of phenotype-genotype relationships and tissue response to pharmacological manipulation. Mutations in the <i>TSC1</i> and <i>TSC2</i> genes lead to dysfunctional mTOR signaling and cause tuberous sclerosis complex (TSC), a genetic disorder that affects multiple organ systems, principally the brain, heart, skin, and kidneys. Here we differentiated healthy (CC3) and tuberous sclerosis (TSP8-15) human induced pluripotent stem cells (hiPSCs) into cardiomyocytes to create engineered cardiac tissue constructs (ECTCs). We investigated and compared their mechano-elastic properties and gene expression and assessed the effects of rapamycin, a potent inhibitor of the mechanistic target of rapamycin (mTOR). The TSP8-15 ECTCs had increased chronotropy compared to healthy ECTCs. Rapamycin induced positive inotropic and chronotropic effects (i.e., increased contractility and beating frequency, respectively) in the CC3 ECTCs but did not cause significant changes in the TSP8-15 ECTCs. A differential gene expression analysis revealed 926 up- and 439 down-regulated genes in the TSP8-15 ECTCs compared to their healthy counterparts. The application of rapamycin initiated the differential expression of 101 and 31 genes in the CC3 and TSP8-15 ECTCs, respectively. A gene ontology analysis showed that in the CC3 ECTCs, the positive inotropic and chronotropic effects of rapamycin correlated with positively regulated biological processes, which were primarily related to the metabolism of lipids and fatty and amino acids, and with negatively regulated processes, which were predominantly associated with cell proliferation and muscle and tissue development. In conclusion, this study describes for the first time an in vitro TSC cardiac tissue model, illustrates the response of normal and TSC ECTCs to rapamycin, and provides new insights into the mechanisms of TSC.

PRDX6
Also flagged:Ferroptosisdeathautophagyblood diseasesironlipid
Journal Article 2024-02-28 ✓ 5 Snippets Punziano C, Trombetti S, Cesaro E, Grosso M, Faraonio R.
In-Text Gene Mentions

Finally, in another recent study, the protein levels of PRDX6 (and ACSL3) were found to be higher in tumor tissues of lung adenocarcinoma, implicating a possible role of PRDX6 in ferroptosis resistance in lung cancer cells [241].

This involves the antioxidant pathways of GPX4/glutathione/cysteine, peroxiredoxin 6 (PRDX6), the mevalonate pathway, FSP1/coenzyme Q10 (CoQ10), microsomal glutathione transferase 1 (MGST1), mitochondrial GPD2/DHODH/CoQ10, and the GCH1/tetrahydrobiopterin (BH4) system that can also act in concert with other defenses able to fine-tune the lipid composition (Figure 5).

Actually, the protective role of PRDX6 against ferroptosis has been proven to be important in diabetic kidney diseases [239], inflammatory bowel disease [240], and periodontitis [240].

Moreover, decreased PRDX6 (and GPX4) expression after knockdown of NOTCH3, a signaling membrane receptor, could initiate ferroptosis by increasing ROS/lipid peroxidation and iron in non-small cell lung cancer cells [242].

As mentioned above, PRDX6 can mediate lipid repair through three functions: (i) direct reduction of PLOOH to alcohol (PLOH) using the GSH-dependent PRDX6/PHGP activity, like GPX4; (ii) removal of the LOOH moiety using a unique Ca2+-independent phospholipase A2 activity (PRDX6/PLA2) toward phosphatidylcholine peroxides (PCOOH), producing lysoPC; and (iii) reacylation of lysoPC with reduced FA-CoA by an intrinsic coupled LPCAT activity (PRDX6/LPCAT) [231,233,234,235].

Show Full Abstract

Ferroptosis is a type of programmed cell death that differs from apoptosis, autophagy, and necrosis and is related to several physio-pathological processes, including tumorigenesis, neurodegeneration, senescence, blood diseases, kidney disorders, and ischemia-reperfusion injuries. Ferroptosis is linked to iron accumulation, eliciting dysfunction of antioxidant systems, which favor the production of lipid peroxides, cell membrane damage, and ultimately, cell death. Thus, signaling pathways evoking ferroptosis are strongly associated with those protecting cells against iron excess and/or lipid-derived ROS. Here, we discuss the interaction between the metabolic pathways of ferroptosis and antioxidant systems, with a particular focus on transcription factors implicated in the regulation of ferroptosis, either as triggers of lipid peroxidation or as ferroptosis antioxidant defense pathways.

PEBP1
Also flagged:cancerferroptosisdeathlipogenesiserastinferrostatin-1
Journal Article 2024-02-28 ✓ 3 Snippets Varynskyi B, Schick JA.
In-Text Gene Mentions

…ng protein 1/15-lipoxygenase (PEBP1/15LOX) complex in ferroptosis…

…not bound toPEBP1, peroxidizes free fatty…

…However, thePEBP1/15LOX complex is capable…

Show Full Abstract

The concept of redirecting metabolic pathways in cancer cells for therapeutic purposes has become a prominent theme in recent research. Now, with the advent of ferroptosis, a new chink in the armor has evolved that allows for repurposing of ferroptosis-sensitive lipids in order to trigger cell death. This review presents the historical context of lipidomic and metabolic alterations in cancer cells associated with ferroptosis sensitization. The main proferroptotic genes and pathways are identified as therapeutic targets for increasing susceptibility to ferroptosis. In this review, a particular emphasis is given to pathways in cancer cells such as de novo lipogenesis, which has been described as a potential target for ferroptosis sensitization. Additionally, we propose a connection between ketolysis inhibition and sensitivity to ferroptosis as a new vulnerability in cancer cells. The main proferroptotic genes and pathways have been identified as therapeutic targets for increasing susceptibility to ferroptosis. Proferroptotic metabolic pathways and vulnerable points, along with suggested agonists or antagonists, are also discussed. Finally, general therapeutic strategies for ferroptosis sensitization based on the manipulation of the lipidome in ferroptosis-resistant cancer cell lines are proposed.

Also flagged:intraventricular hemorrhagegestationpathogenesissepsisdeathchromosomal abnormalities
Journal Article 2024-02-28 No Snippets Cucerea M, Moscalu M, Simon M, Ognean ML, Mitranovici MI, Chiorean DM, Marian R.
Show Full Abstract

<i>Background and Objectives</i>: The purpose of this study to investigate if the early variations in the hematological profile could be a useful tool in the prediction and evaluation of intraventricular hemorrhage. <i>Materials and Methods</i>: It is a retrospective study conducted between 1 January 2017 and 31 December 2022, in a tertiary academic center. In-born infants ≤ 28 weeks of gestation (<i>n</i> = 134) were enrolled. The study group of infants with all grades of IVH was further divided into mild IVH subgroups (grades 1 and 2) and severe IVH subgroups (grades 3 and 4); the control group included infants without IVH. <i>Results</i>: The prevalence of IVH was 35.8% (<i>n</i> = 48 of 134 infants-study group). We identified significantly lower median values of HGB (<i>p</i> = 0.0312) and HCT (<i>p</i> = 0.0172) in all grades of the IVH group at birth as compared with control, followed by a significantly higher drop in MCV (<i>p</i> = 0.0146) and MCH (<i>p</i> = 0.0002) in the fourth day of life. <i>Conclusions</i>: Extremely preterm infants with IVH may have lower HTC and HGB values at birth, together with a decrease in MCH and MCHC and increase in MPV. The predictive model based on logistic regression analysis could predict the probability of the occurrence of IVH according to their values.

SERPINC1
Also flagged:Leptomeningeal Carcinomatosiscancertumormelanoma cancercarcinomatous meningitisleptomeningeal disease
Journal Article 2024-02-28 ✓ 1 Snippet Goldberg M, Mondragon-Soto MG, Altawalbeh G, Meyer B, Aftahy AK.
In-Text Gene Mentions

…LC, including PTPRC,SERPINC1, sCD44, sCD14, ANPEP,…

Show Full Abstract

Leptomeningeal carcinomatosis represents a terminal stage and is a devastating complication of cancer. Despite its high incidence, current diagnostic methods fail to accurately detect this condition in a timely manner. This failure to diagnose leads to the refusal of treatment and the absence of clinical trials, hampering the development of new therapy strategies. The use of liquid biopsy is revolutionizing the field of diagnostic oncology. The dynamic and non-invasive detection of tumor markers has enormous potential in cancer diagnostics and treatment. Leptomeningeal carcinomatosis is a condition where invasive tissue biopsy is not part of the routine diagnostic analysis, making liquid biopsy an essential diagnostic tool. Several elements in cerebrospinal fluid (CSF) have been investigated as potential targets of liquid biopsy, including free circulating tumor cells, free circulating nucleic acids, proteins, exosomes, and even non-tumor cells as part of the dynamic tumor microenvironment. This review aims to summarize current breakthroughs in the research on liquid biopsy, including the latest breakthroughs in the identification of tumor cells and nucleic acids, and give an overview of future directions in the diagnosis of leptomeningeal carcinomatosis.

HFE
Also flagged:diabetesnon-alcoholic fatty liver diseaseNAFLDalanine aminotransferaseALTtype 2 diabetes mellitus
Journal Article 2024-02-28 ✓ 1 Snippet Akhtar A, Ijaz H, Waseem M, Khan MI, Saif Y, Iqbal H, Batool SA, Kumari U, Surani S, Khan A.
In-Text Gene Mentions

…intake, viral hepatitis,hemochromatosis, and Wilson’s disease…

Show Full Abstract

<h4>Background and objectives</h4>Non-alcoholic fatty liver disease (NAFLD) is characterized by ectopic deposition of fat in the liver, in the absence of other secondary causes of fat buildup. The relationship between NAFLD, including alanine aminotransferase (ALT), and glycated haemoglobin (HbA1c), is important for predicting the severity of disease and prognosis. This study aims to investigate the association of HbA1c in type 2 diabetes mellitus (T2DM) patients with NAFLD via measuring the ALT levels.<h4>Materials and methods</h4>This retrospective cross-sectional study enroled 130 patients with T2DM and NAFLD. The association between levels of HbA1c and ALT in patients of NAFLD with controlled and uncontrolled T2DM, respectively, was investigated. Stratification was done based on gender and diabetic control, using HbA1c levels as a marker of glycemic control. Serum ALT levels were also compared in both groups.<h4>Results</h4>The mean age of the participants was 50.2±5.7 years. The total participants were 130, of which 77 (59.3%) were females and 53 (40.7%) were males. The numbers of patients having uncontrolled T2DM (HbA1c>7%), and controlled T2DM (HbA1c <7%) were 78 (60%) and 52 (40%), respectively. Moreover, 46 (35.3%) females and 32 (24.7%) males had uncontrolled T2DM, and 31 (23.8%) females and 21 (16.2%) males had controlled T2DM. The mean ALT level for uncontrolled and controlled T2DM in female patients was found to be 24.6±3.4 and 13.5±2.4, respectively, (<i>P</i> <0.05). For male patients, it was found to be 54.0±4.9 and 29.1±5.4, respectively (<i>P</i>=0.008).<h4>Conclusion</h4>There is a positive association between elevated HbA1c and ALT levels in T2DM patients with NAFLD.

Also flagged:Hirschsprung's diseaseHSCRcongenitalpathogenesisaganglionosiscongenital disorder
Journal Article 2024-02-28 No Snippets Yang Y, Hou X, Wang C, Chen Q, Lu Y, Yu D, Wu K.
Show Full Abstract

Hirschsprung's disease (HSCR) is a congenital disorder characterized by the absence of ganglion cells in the colon, leading to various intestinal complications. The etiology of HSCR stems from complex genetic and environmental interactions, of which the intricate roles of non-coding RNAs (ncRNAs) are a key area of research. However, the roles of ncRNAs in the pathogenesis of HSCR have not been fully elucidated. In order to understand the variety of symptoms caused by HSCR and develop new therapeutic approaches, it is essential to understand the underlying biological genetic basis of HSCR. This review presents a comprehensive overview of the current understanding regarding the involvement of ncRNAs in HSCR, including microRNAs (miRNAs), long noncoding RNAs (lncRNAs), and circular RNAs (circRNAs). Additionally, it provides a summary of the molecular mechanisms through which ncRNAs regulate the expression of genes related to the proliferation, migration, and differentiation of intestinal neural crest cells, thereby contributing to the advancement of HSCR research.

Also flagged:psychopathologiesdepressionschizophreniaautismgene expressionpsychiatric diseases
Journal Article 2024-02-28 No Snippets Proshina EA, Deynekina TS, Martynova OV.
Show Full Abstract

Owing to the advances of neuroimaging techniques, a number of functional brain networks associated both with specific functions and the state of relative inactivity has been distinguished. A sufficient bulk of information has been accumulated on changes in connectivity (links between brain regions) in psychopathologies, for example, depression, schizophrenia, autism. Their genetic markers are being actively investigated using a candidate-gene approach or a genome-wide association study. At the same time, there is not much data considering connectivity as an intermediate link in the genotype-pathology chain, although it seems to be a reliable endophenotype, since it demonstrates a high stability and high heritability. In the present review, we consider the results of investigations devoted to the search for biomarkers, molecular and genetic associations of functional, partially anatomical, and effective connectivity. The main approaches to the evaluation of connectivity neurogenetics have been described, as well as specific genetic variants, for which the association with brain connectivity in psychiatric pathologies has been detected.

HFE
Also flagged:congenital heart diseasecongestive hepatopathyamyloidosisalcohol induced myopathiesliver diseasebasiliximab
Journal Article 2024-02-28 ✓ 1 Snippet Nandkeolyar S, Gupta T, Brinkley DM, Alexopoulos S, Firsich E, Fossey SA, Fowler R, Frischhertz B, Harrison K, Lindenfeld J, Montenovo M, Pedrotty D, Punnoose L, Rali A, Shingina A, Schlendorf K, Siddiqi H, Shah A, Zalawadiya S, Wigger M, Menachem JN.
In-Text Gene Mentions

…tive hepatopathy, amyloidosis,hemochromatosis, or alcohol induced…

Show Full Abstract

<h4>Introduction</h4>Each year the number of combined heart-liver transplants (HLT) increases, with two distinct patient populations proceeding down this pathway. The first are patients with congenital heart disease (CHD), most commonly single ventricle patients palliated with Fontan. The second group are those with long standing congestive hepatopathy, amyloidosis, hemochromatosis, or alcohol induced myopathies and liver disease.One argument for HLT has been the low rate of rejection even among sensitized patients, with reported rejection rates ranging from 0% to 31%. Historically, those with CHD have been highly sensitized which in some cases may prevent or at least delay transplantation. As such, a recent consensus statement by Emamaulee et al. suggest that "there may be an immunological benefit to proceed with HLT with significantly fewer acute cellular and humoral rejection episodes". The aim of this study is to demonstrate that HLT patients remain at risk for rejection and have required treatment for it.<h4>Results</h4>There were 15 patients who underwent HLT from January 2017 to February 2022. Of the four patients who did not have CHD, none were considered sensitized, and all underwent induction with basiliximab per our institutional protocol. One of these had rejection. Rejection episodes were identified in four of the 11 CHD patients (36%) patients.<h4>Conclusions</h4>In our study of 15 HLT, including 11 CHD patients (73% denied transplant at ≥ 1 center) demonstrated a higher rate of rejection than previously reported. While theoretically, HLT may mitigate the likelihood of rejection, the risk still exists, and patients benefit from close monitoring commensurate with single organ transplant.

HFEOLFM4
Also flagged:ironinnate immunityGene Expressionneutrophildegranulationimmune response
Journal Article 2024-02-28 ✓ 5 Snippets Feng Z, Fan Y, Shi X, Luo X, Xie J, Liu S, Duan C, Wang Q, Ye Y, Yin W.
In-Text Gene Mentions

…(LTF), Olfactomedin 4 (OLFM4), Resistin (RETN), and…

…follows: FXN, HEPH,HFE, LCN2, LTF, MFI2,…

…CTSD, LTF, RETN,OLFM4, PGLYRP1, ARG1, FPR2,…

…(LCN2, LTF, MUCL3,OLFM4, RETN, and TCN1)…

…including LCN2, LTF,OLFM4, RETN, and TCN1…

Show Full Abstract

No abstract available.

medRxiv 2024-02-28 Preprint (No Snippets API) Konigsberg IR, Vu T, Liu W, Litkowski EM, Pratte KA, Vargas LB, Gilmore N, Abdel-Hafiz M, Manichaikul AW, Cho MH, Hersh CP, DeMeo DL, Banaei-Kashani F, Bowler RP, Lange LA, Kechris KJ.
Show Full Abstract

<h4>Background</h4> Studies have identified individual blood biomarkers associated with chronic obstructive pulmonary disease (COPD) and related phenotypes. However, complex diseases such as COPD typically involve changes in multiple molecules with interconnections that may not be captured when considering single molecular features. <h4>Methods</h4> Leveraging proteomic data from 3,173 COPDGene Non-Hispanic White (NHW) and African American (AA) participants, we applied sparse multiple canonical correlation network analysis (SmCCNet) to 4,776 proteins assayed on the SomaScan v4.0 platform to derive sparse networks of proteins associated with current vs. former smoking status, airflow obstruction, and emphysema quantitated from high-resolution computed tomography scans. We then used NetSHy, a dimension reduction technique leveraging network topology, to produce summary scores of each proteomic network, referred to as NetSHy scores. We next performed genome-wide association study (GWAS) to identify variants associated with the NetSHy scores, or network quantitative trait loci (nQTLs). Finally, we evaluated the replicability of the networks in an independent cohort, SPIROMICS. <h4>Results</h4> We identified networks of 13 to 104 proteins for each phenotype and exposure in NHW and AA, and the derived NetSHy scores significantly associated with the variable of interests. Networks included known (sRAGE, ALPP, MIP1) and novel molecules (CA10, CPB1, HIS3, PXDN) and interactions involved in COPD pathogenesis. We observed 7 nQTL loci associated with NetSHy scores, 4 of which remained after conditional analysis. Networks for smoking status and emphysema, but not airflow obstruction, demonstrated a high degree of replicability across race groups and cohorts. <h4>Conclusions</h4> In this work, we apply state-of-the-art molecular network generation and summarization approaches to proteomic data from COPDGene participants to uncover protein networks associated with COPD phenotypes. We further identify genetic associations with networks. This work discovers protein networks containing known and novel proteins and protein interactions associated with clinically relevant COPD phenotypes across race groups and cohorts.

medRxiv 2024-02-28 Preprint (No Snippets API) Wang FM, Ruby JG, Sethi A, Veras M, Telis N, Melamud E.
Show Full Abstract

Increased spinal curvature is one of the most recognizable aging traits in the human population. However, despite high prevalence, the etiology of this condition remains poorly understood. To gain better insight into the physiological, biochemical, and genetic risk factors involved, we developed a novel machine learning method to automatically derive thoracic kyphosis and lumbar lordosis angles from dual-energy X-ray absorptiometry (DXA) scans in the UK Biobank Imaging cohort. In 41,212 participants, we find that on average males and females gain 2.42° kyphotic and 1.48° lordotic angle per decade of life. Increased spinal curvature was strongly associated with decreased muscle mass and bone mineral density. Adiposity had opposing associations, with decreased kyphosis and increased lordosis. To gain further insight into the molecular mechanisms involved, we carried out a genome-wide association study and identified several risk loci associated with both traits. Using Mendelian randomization, we further show that genes fundamental to the maintenance of musculoskeletal function (COL11A1, PTHLH, ETFA, TWIST1) and cellular homeostasis such as RNA transcription and DNA repair (RAD9A, MMS22L, HIF1A, RAB28) are likely involved in increased spinal curvature.

HFE
Also flagged:Alanine AminotransferaseALTmetabolismdigestiondetoxificationamino acids
Journal Article 2024-02-27 ✓ 1 Snippet Moriles KE, Zubair M, Azer SA.
In-Text Gene Mentions

…Other causes includehemochromatosis, vascular disease, acute…

Show Full Abstract

Alanine aminotransferase (ALT) is an enzyme found predominantly in the liver but also in other tissues such as the kidneys, heart, and muscle cells. An increase in ALT serum levels indicates definite liver cell injury due to many causes. An ALT blood test is often included in a liver panel and comprehensive metabolic panel to assess for damage to the liver.  The liver has a central and critical biochemical role in the metabolism, digestion, detoxification, and elimination of substances from the body. All blood from the intestinal tract initially passes through the liver, where products derived from the digestion of food are processed, transformed, and stored. These include amino acids, carbohydrates, fatty acids, cholesterol, lipids, vitamins, and minerals. Most major plasma proteins (except immunoglobulins and the von Willebrand factor) are mainly or exclusively synthesized in the liver. The liver responds to multiple hormonal and neural stimuli to regulate blood glucose concentrations. Not only does the organ extract glucose from the blood to generate energy, but it also stores dietary glucose as glycogen for later use. The liver is also the major site for gluconeogenesis, which is critical for maintaining blood glucose concentration in the fasting state. The liver is central in lipid metabolism; it extracts and processes dietary lipids and is the principal site of cholesterol, triglyceride, and lipoprotein synthesis. Another major liver function is the synthesis of bile acids from cholesterol, with the secretion of these compounds into the bile, which facilitates the absorption of dietary fat and fat-soluble vitamins. The liver is also the primary site of metabolism of both endogenous substances and exogenous compounds (eg, drugs and toxins). This process, known as biotransformation, converts lipophilic substances to hydrophilic ones for subsequent elimination. The liver is a major site of hormone catabolism and regulates plasma hormone concentrations. The liver is also involved in hormone synthesis, producing the hormones insulin-like growth factor 1 (IGF-1), angiotensinogen, hepcidin, thrombopoietin, erythropoietin, and the prohormone 25-OH vitamin D. Many of these hepatic functions can be assessed by laboratory procedures to gain insight into the integrity of the liver. As a large organ, the liver has extensive reserve capacity to perform its functions in coordination with other organs. Individuals with liver disease maintain normal function despite extensive liver damage. In such cases, liver disease may be recognized only using tests that detect injury. Most commonly, this is accomplished by measuring the plasma activities of enzymes found within liver cells, which are released in specific patterns with different forms of injury. Chronic liver injury involves fibrosis in the liver. Markers of the fibrotic process might indicate the degree of injury. Chronic damage is often due to chronic inflammation. Cytokines can alter the liver's protein production pattern, making it possible to detect inflammation, not necessarily related to the liver. Some proteins are produced in increased amounts with liver regeneration and neoplasia; the markers may be useful in detecting liver cell proliferation. This review focuses on the significance of ALT in assessing hepatic injury and malfunction. ALT is aggregated primarily in the cytosol of hepatocytes, consists of 496 amino acids, and has a half-life of approximately 47 hours. ALT is detectable in serum at low concentrations (typically <30 IU/L). However, any process that leads to loss of hepatocyte membrane integrity or necrosis results in the release of ALT in high concentrations in the plasma. Therefore, the elevation of serum ALT concentration is sensitive but not specific to measure hepatocellular injury, as the degree of elevation cannot determine the exact cause. The most common causes are alcohol-induced liver injury, non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), chronic hepatitis B or C, autoimmune hepatitis, and drug or herbal supplement-induced liver injury. Other causes include hemochromatosis, vascular disease, acute viral hepatitis, and genetic disorders affecting the liver.

Also flagged:cancerexonucleasesgene expressionbindingtumoursnucleotide
Journal Article 2024-02-27 No Snippets Niu M, Wang C, Chen Y, Zou Q, Qi R, Xu L.
Show Full Abstract

<h4>Background</h4>Circular RNAs (circRNAs) can regulate microRNA activity and are related to various diseases, such as cancer. Functional research on circRNAs is the focus of scientific research. Accurate identification of circRNAs is important for gaining insight into their functions. Although several circRNA prediction models have been developed, their prediction accuracy is still unsatisfactory. Therefore, providing a more accurate computational framework to predict circRNAs and analyse their looping characteristics is crucial for systematic annotation.<h4>Results</h4>We developed a novel framework, CircDC, for classifying circRNAs from other lncRNAs. CircDC uses four different feature encoding schemes and adopts a multilayer convolutional neural network and bidirectional long short-term memory network to learn high-order feature representation and make circRNA predictions. The results demonstrate that the proposed CircDC model is more accurate than existing models. In addition, an interpretable analysis of the features affecting the model is performed, and the computational framework is applied to the extended application of circRNA identification.<h4>Conclusions</h4>CircDC is suitable for the prediction of circRNA. The identification of circRNA helps to understand and delve into the related biological processes and functions. Feature importance analysis increases model interpretability and uncovers significant biological properties. The relevant code and data in this article can be accessed for free at https://github.com/nmt315320/CircDC.git .

Also flagged:Boronic acidpenicillin-binding protein 1bserinecell wallbiosynthesisPBP1b
Journal Article 2024-02-27 No Snippets Kollár L, Grabrijan K, Hrast Rambaher M, Bozovičar K, Imre T, Ferenczy GG, Gobec S, Keserű GM.
Show Full Abstract

Penicillin-binding proteins (PBPs) contribute to bacterial cell wall biosynthesis and are targets of antibacterial agents. Here, we investigated PBP1b inhibition by boronic acid derivatives. Chemical starting points were identified by structure-based virtual screening and aliphatic boronic acids were selected for further investigations. Structure-activity relationship studies focusing on the branching of the boron-connecting carbon and quantum mechanical/molecular mechanical simulations showed that reaction barrier free energies are compatible with fast reversible covalent binding and small or missing reaction free energies limit the inhibitory activity of the investigated boronic acid derivatives. Therefore, covalent labelling of the lysine residue of the catalytic dyad was also investigated. Compounds with a carbonyl warhead and an appropriately positioned boronic acid moiety were shown to inhibit and covalently label PBP1b. Reversible covalent labelling of the catalytic lysine by imine formation and the stabilisation of the imine by dative N-B bond is a new strategy for PBP1b inhibition.

HTT
Also flagged:gene expressiondiacetylhistone deacetylasesHDACshistoneHDAC
Journal Article 2024-02-27 ✓ 1 Snippet Haga-Yamanaka S, Nunez-Flores R, Scott CA, Perry S, Chen ST, Pontrello C, Nair MG, Ray A.
In-Text Gene Mentions

…polyglutamine-domain of theHttprotein, which binds…

Show Full Abstract

Eukaryotes respond to secreted metabolites from the microbiome. However, little is known about the effects of exposure to volatiles emitted by microbes or in the environment that we are exposed to over longer durations. Using <i>Drosophila melanogaster,</i> we evaluated a yeast-emitted volatile, diacetyl, found at high levels around fermenting fruits where they spend long periods of time. Exposure to the diacetyl molecules in headspace alters gene expression in the antenna. <i>In vitro</i> experiments demonstrated that diacetyl and structurally related volatiles inhibited conserved histone deacetylases (HDACs), increased histone-H3K9 acetylation in human cells, and caused changes in gene expression in both <i>Drosophila</i> and mice. Diacetyl crosses the blood-brain barrier and exposure caused modulation of gene expression in the mouse brain, therefore showing potential as a neuro-therapeutic. Using two separate disease models previously known to be responsive to HDAC inhibitors, we evaluated the physiological effects of volatile exposure. Diacetyl exposure halted proliferation of a neuroblastoma cell line in culture. Exposure to diacetyl vapors slowed progression of neurodegeneration in a <i>Drosophila</i> model for Huntington's disease. These changes strongly suggest that certain volatiles in the surroundings can have profound effects on histone acetylation, gene expression, and physiology in animals.

DCC
Also flagged:axoncalciumpentylenetetrazolaxonalSpinal cord injurycord injury
Journal Article 2024-02-27 ✓ 1 Snippet Shen Y, Chen X, Song Z, Yao H, Han A, Zhang Y, Cai Y, Hu B.
In-Text Gene Mentions

…cells by targetingDcc[ 53 ].…

Show Full Abstract

MicroRNA (miRNA), functioning as a post-transcriptional regulatory element, plays a significant role in numerous regulatory mechanisms and serves as a crucial intrinsic factor influencing axon regeneration. Prior investigations have elucidated the involvement of miRNA-9 in various processes, however, its specific contribution to axon regeneration in the central nervous system (CNS) remains uncertain. Hence, the zebrafish Mauthner axon regeneration model was employed to manipulate the expression of miRNA-9 in single cells, revealing that upregulation of miRNA-9 facilitated axon regeneration. Additionally, her6, a downstream target gene of miRNA-9, was identified as a novel gene associated with axon regeneration. Suppression of her6 resulted in enhanced Mauthner axon regeneration, as evidenced by the significantly improved regenerative capacity observed in her6 knockout zebrafish. In addition, modulation of her6 expression affects intracellular calcium levels in neurons and promoting her6 expression leads to a decrease in calcium levels in vivo using the new NEMOf calcium indicator. Moreover, the administration of the neural activity activator, pentylenetetrazol (PTZ) partially compensated for the inhibitory effect of her6 overexpression on the calcium level and promoted axon regeneration. Taken together, our study revealed a role for miRNA-9 in the process of axon regeneration in the CNS, which improved intracellular calcium activity and promoted axon regeneration by inhibiting the expression of downstream target gene her6. In our study, miRNA-9 emerged as a novel and intriguing target in the intricate regulation of axon regeneration and offered compelling evidence for the intricate relationship between calcium activity and the facilitation of axon regeneration.

SOX6
Also flagged:brain developmentNeuronalaction potentialssynapsesmembranecytoskeletal proteins
Journal Article 2024-02-27 ✓ 1 Snippet Ciceri G, Studer L.
In-Text Gene Mentions

SOX6

Show Full Abstract

During brain development, the sequence of developmental steps and the underlying transcriptional regulatory logic are largely conserved across species. However, the temporal unfolding of developmental programs varies dramatically across species and within a given species varies across brain regions and cell identities. The maturation of neurons in the human cerebral cortex is particularly slow and lasts for many years compared with only a few weeks for the corresponding mouse neurons. The mechanisms setting the 'schedule' of neuronal maturation remain unclear but appear to be linked to a cell-intrinsic 'clock'. Here, we discuss recent findings that highlight a role for epigenetic factors in the timing of neuronal maturation. Manipulations of those factors in stem cell-based models can override the intrinsic pace of neuronal maturation, including its protracted nature in human cortical neurons. We then contextualize the epigenetic regulation of maturation programs with findings from other model systems and propose potential interactions between epigenetic pathways and other drivers of developmental rates.

Also flagged:Synthesiscyanine 5cyaninedegradationcancerpentamethine
Journal Article 2024-02-27 No Snippets Maller C, Schedel F, Köhn M.
Show Full Abstract

Herein, we present a straightforward synthetic route for the design and synthesis of diverse heterobifunctional cyanine 5 dyes. We optimized the workup by harnessing the pH- and functional group-dependent solubility of the asymmetric cyanine 5 dyes. Therefore, purification through chromatography is deferred until the last synthesis step. Demonstrating successful large-scale synthesis, our modular approach prevents functional group degradation by introducing them in the last synthesis step. These modifiable heterobifunctional dyes offer significant utility in advancing biological studies.

Also flagged:gene expressiontranscription factorsneuroblastomametastatic tumorinfectionC/EBP
Journal Article 2024-02-27 No Snippets Kirchberger S, Shoeb MR, Lazic D, Wenninger-Weinzierl A, Fischer K, Shaw LE, Nogueira F, Rifatbegovic F, Bozsaky E, Ladenstein R, Bodenmiller B, Lion T, Traver D, Farlik M, Schöfer C, Taschner-Mandl S, Halbritter F, Distel M.
Show Full Abstract

Neutrophils are evolutionarily conserved innate immune cells playing pivotal roles in host defense. Zebrafish models have contributed substantially to our understanding of neutrophil functions but similarities to human neutrophil maturation have not been systematically characterized, which limits their applicability to studying human disease. Here we show, by generating and analysing transgenic zebrafish strains representing distinct neutrophil differentiation stages, a high-resolution transcriptional profile of neutrophil maturation. We link gene expression at each stage to characteristic transcription factors, including C/ebp-β, which is important for late neutrophil maturation. Cross-species comparison of zebrafish, mouse, and human samples confirms high molecular similarity of immature stages and discriminates zebrafish-specific from pan-species gene signatures. Applying the pan-species neutrophil maturation signature to RNA-sequencing data from human neuroblastoma patients reveals association between metastatic tumor cell infiltration in the bone marrow and an overall increase in mature neutrophils. Our detailed neutrophil maturation atlas thus provides a valuable resource for studying neutrophil function at different stages across species in health and disease.

HFE
Also flagged:ApomorphinedopamineDopamine D1 receptorD5 receptormitochondrial diseasesferroptosis
Journal Article 2024-02-27 ✓ 1 Snippet Miyauchi A, Watanabe C, Yamada N, Jimbo EF, Kobayashi M, Ohishi N, Nagayoshi A, Aoki S, Kishita Y, Ohtake A, Ohno N, Takahashi M, Yamagata T, Osaka H.
In-Text Gene Mentions

…toxicity, liver fibrosis,hemochromatosis, and cardiomyopathy 13…

Show Full Abstract

Originally, apomorphine was a broad-spectrum dopamine agonist with an affinity for all subtypes of the Dopamine D1 receptor to the D5 receptor. We previously identified apomorphine as a potential therapeutic agent for mitochondrial diseases by screening a chemical library of fibroblasts from patients with mitochondrial diseases. In this study, we showed that apomorphine prevented ferroptosis in fibroblasts from various types of mitochondrial diseases as well as in normal controls. Well-known biomarkers of ferroptosis include protein markers such as prostaglandin endoperoxide synthase 2 (PTGS2), a key gene for ferroptosis-related inflammation PTGS2, lipid peroxidation, and reactive oxygen species. Our findings that apomorphine induced significant downregulation of PTSG2 and suppressed lipid peroxide to the same extent as other inhibitors of ferroptosis also indicate that apomorphine suppresses ferroptosis. To our knowledge, this is the first study to report that the anti-ferroptosis effect of apomorphine is not related to dopamine receptor agonist action and that apomorphine is a potent inhibitor of ferroptotic cell death independent of dopaminergic receptors.

Also flagged:triglyceridePhospholipidsgene expressionPLIPadipocytokineMAPK
Journal Article 2024-02-27 No Snippets Zhu J, Wang Y, Su Y, Zheng M, Cui H, Chen Z.
Show Full Abstract

<h4>Background</h4>Intramuscular fat (IMF) is an important factor in meat quality, and triglyceride (TG) and Phospholipids (PLIP), as the main components of IMF, are of great significance to the improvement of meat quality.<h4>Results</h4>In this study, we used 30 RNA sequences generated from the transcriptome of chicken breast muscle tissues at different developmental stages to construct a gene expression matrix to map RNA sequence reads to the chicken genome and identify the transcript of origin. We used weighted gene co-expression network analysis (WGCNA) and identified 27 co-expression modules, 10 of which were related to TG and PLIP. We identified 150 highly-connected hub genes related to TG and PLIP, respectively, which were found to be mainly enriched in the adipocytokine signaling pathway, MAPK signaling pathway, mTOR signaling pathway, FoxO signaling pathway, and TGF-beta signaling pathway. Additionally, using the BioMart database, we identified 134 and 145 candidate genes related to fat development in the TG-related module and PLIP-related module, respectively. Among them, RPS6KB1, BRCA1, CDK1, RPS3, PPARGC1A, ACSL1, NDUFAB1, NDUFA9, ATP5B and PRKAG2 were identified as candidate genes related to fat development and highly-connected hub genes in the module, suggesting that these ten genes may be important candidate genes affecting IMF deposition.<h4>Conclusions</h4>RPS6KB1, BRCA1, CDK1, RPS3, PPARGC1A, ACSL1, NDUFAB1, NDUFA9, ATP5B and PRKAG2 may be important candidate genes affecting IMF deposition. The purpose of this study was to identify the co-expressed gene modules related to chicken IMF deposition using WGCNA and determine key genes related to IMF deposition, so as to lay a foundation for further research on the molecular regulation mechanism underlying chicken fat deposition.

SOX6
Also flagged:clear cell renal cell carcinomatumorrenal cell carcinomalocalizationtumorsmetabolism
Journal Article 2024-02-27 ✓ 1 Snippet Yang G, Cheng J, Xu J, Shen C, Lu X, He C, Huang J, He M, Cheng J, Wang H.
In-Text Gene Mentions

…endothelial cell (14.98%,SOX6/GLUL/PI16), IGFBP3 + capillar…

Show Full Abstract

<h4>Background</h4>Clear cell renal cell carcinoma is a prototypical tumor characterized by metabolic reprogramming, which extends beyond tumor cells to encompass diverse cell types within the tumor microenvironment. Nonetheless, current research on metabolic reprogramming in renal cell carcinoma mostly focuses on either tumor cells alone or conducts analyses of all cells within the tumor microenvironment as a mixture, thereby failing to precisely identify metabolic changes in different cell types within the tumor microenvironment.<h4>Methods</h4>Gathering 9 major single-cell RNA sequencing databases of clear cell renal cell carcinoma, encompassing 195 samples. Spatial transcriptomics data were selected to conduct metabolic activity analysis with spatial localization. Developing scMet program to convert RNA-seq data into scRNA-seq data for downstream analysis.<h4>Results</h4>Diverse cellular entities within the tumor microenvironment exhibit distinct infiltration preferences across varying histological grades and tissue origins. Higher-grade tumors manifest pronounced immunosuppressive traits. The identification of tumor cells in the RNA splicing state reveals an association between the enrichment of this particular cellular population and an unfavorable prognostic outcome. The energy metabolism of CD8<sup>+</sup> T cells is pivotal not only for their cytotoxic effector functions but also as a marker of impending cellular exhaustion. Sphingolipid metabolism evinces a correlation with diverse macrophage-specific traits, particularly M2 polarization. The tumor epicenter is characterized by heightened metabolic activity, prominently marked by elevated tricarboxylic acid cycle and glycolysis while the pericapsular milieu showcases a conspicuous enrichment of attributes associated with vasculogenesis, inflammatory responses, and epithelial-mesenchymal transition. The scMet facilitates the transformation of RNA sequencing datasets sourced from TCGA into scRNA sequencing data, maintaining a substantial degree of correlation.<h4>Conclusions</h4>The tumor microenvironment of clear cell renal cell carcinoma demonstrates significant metabolic heterogeneity across various cell types and spatial dimensions. scMet exhibits a notable capability to transform RNA sequencing data into scRNA sequencing data with a high degree of correlation.

DCC
Also flagged:Calcinosis Cutisosteomyelitischronic venous insufficiencyhereditary hemochromatosissquamous cell carcinomadystrophic calcinosis cutis
Journal Article 2024-02-27 ✓ 4 Snippets Kyoung J, Caudill J, Workman L, Simman R.
In-Text Gene Mentions

…6DCCis the most…

…the manifestation ofDCCin our patient’s…

…in contrast toDCC, is associated with…

…the diagnosis ofDCC.…

Show Full Abstract

The presence of bony-appearing fragments and calcifications appearing superficially in a chronic, nonhealing wound raises suspicion for osteomyelitis. When radiological imaging and tissue biopsy of the lesion return negative for osteomyelitis, however, the differentials must be widened to successfully manage and heal a chronic wound. In this report, we discuss a case of an 80-year-old morbidly obese woman with a history of chronic venous insufficiency, hereditary hemochromatosis, and squamous cell carcinoma who presented to the wound clinic with a 5-month history of a nonhealing wound with bony-appearing fragments and calcifications on her left anterior leg status postbiopsy during routine skin examination. Upon clinical correlation with laboratories and imaging, it was determined that the cause of her nonhealing wound was due to dystrophic calcinosis cutis.

Also flagged:Single-nucleusautosomal dominantAlzheimer's diseaseautosomal dominant Alzheimer's diseaseADnucleus
Journal Article 2024-02-27 No Snippets Almeida MC, Eger SJ, He C, Audouard M, Nikitina A, Glasauer SMK, Han D, Mejía-Cupajita B, Acosta-Uribe J, Villalba-Moreno ND, Littau JL, Elcheikhali M, Rivera EK, Carrettiero DC, Villegas-Lanau CA, Sepulveda-Falla D, Lopera F, Kosik KS.
Show Full Abstract

Highly penetrant autosomal dominant Alzheimer's disease (ADAD) comprises a distinct disease entity as compared to the far more prevalent form of AD in which common variants collectively contribute to risk. The downstream pathways that distinguish these AD forms in specific cell types have not been deeply explored. We compared single-nucleus transcriptomes among a set of 27 cases divided among PSEN1-E280A ADAD carriers, sporadic AD, and controls. Autophagy genes and chaperones clearly defined the PSEN1-E280A cases compared to sporadic AD. Spatial transcriptomics validated the activation of chaperone-mediated autophagy genes in PSEN1-E280A. The PSEN1-E280A case in which much of the brain was spared neurofibrillary pathology and harbored a homozygous APOE3-Christchurch variant revealed possible explanations for protection from AD pathology including overexpression of LRP1 in astrocytes, increased expression of FKBP1B, and decreased PSEN1 expression in neurons. The unique cellular responses in ADAD and sporadic AD require consideration when designing clinical trials.

BTN3A3BTN2A1
Also flagged:acute myeloid leukemiaAMLmajor histocompatibility complexadaptive immunityphosphoantigensbinding
Journal Article 2024-02-27 ✓ 5 Snippets Rao A, Agrawal A, Borthakur G, Battula VL, Maiti A.
In-Text Gene Mentions

It indirectly sends activating signals to the Vγ9Vδ2 T cells through the other isoforms of the BTN protein, such as BTN3A1 (CD277) and BTN3A3.23 Moreover, the TCRs of non-Vγ9Vδ2 T cells such as Vδ1 and Vδ3 T cells, while potentially lacking pAg-BTN-Vγ9 axis recognition capabilities, are capable of more robust recognition of antigens such as pathogenic and non-pathogenic lipids when presented by a member of the CD1 protein family, particularly CD1b, CD1c, or CD1d.26 31 These mechanisms of antigen recognition, which are otherwise typically associated with NK cells, are a key factor in the interest in developing γδ T cell-based therapies in AML and other hematological malignancies.21 24 31 The process of antigen recognition mediated by Vδ1 γδ T cells has been shown to identify leukemia cells with upregulated expression of ULBP2, ULBP3, and MHC class I-related molecule A (figure 2), leading to higher IFN-γ and tumor necrosis factor-mediated antitumor effects, while Vδ2 γδ T cells can recognize upregulated ULBP1 and ULBP2 expression.21 33 AML blasts express high to very high levels of ULBP1, which is a strong incentive for the development of γδ T cells for AML immunotherapy.34 Molecules such as nectin-2 (CD112) and polio virus receptor (CD155), expressed in leukemia cells, may also act as ligands for NK cell receptors like DNAX accessory molecule-1, which have been observed to play an advantageous role in immunotherapy for AML.21 35–38

⭐ same-sentence co-mention

…family (BTN3A1, BTN3A2,BTN3A3, and BTN2A1) of…

⭐ same-sentence co-mention

…BTN3A2, BTN3A3, andBTN2A1) of proteins.…

…21 22BTN2A1protein has a…

…BTN3A1 (CD277) andBTN3A3.…

Show Full Abstract

γδ T cells play an important role in disease control in acute myeloid leukemia (AML) and have become an emerging area of therapeutic interest. These cells represent a minor population of T lymphocytes with intrinsic abilities to recognize antigens in a major histocompatibility complex-independent manner and functionally straddle the innate and adaptive immunity interface. AML shows high expression of phosphoantigens and UL-16 binding proteins that activate the Vδ2 and Vδ1 subtypes of γδ T cells, respectively, leading to γδ T cell-mediated cytotoxicity. Insights from murine models and clinical data in humans show improved overall survival, leukemia-free survival, reduced risk of relapse, enhanced graft-versus-leukemia effect, and decreased graft-versus-host disease in patients with AML who have higher reconstitution of γδ T cells following allogeneic hematopoietic stem cell transplantation. Clinical trials leveraging γδ T cell biology have used unmodified and modified allogeneic cells as well as bispecific engagers and monoclonal antibodies. In this review, we discuss γδ T cells' biology, roles in cancer and AML, and mechanisms of immune escape and antileukemia effect; we also discuss recent clinical advances related to γδ T cells in the field of AML therapeutics.

DARS2
Also flagged:lipidgastrointestinal disordersMitochondrialencephalomyopathiesmuscle atrophymitochondrial aminoacyl-tRNA synthetase
Journal Article 2024-02-27 ✓ 1 Snippet Hu Y, Huang H, Xiang R.
In-Text Gene Mentions

…rial aminoacyl-tRNA synthetaseDARS2to investigate the…

Show Full Abstract

Mitochondrial dysfunctions predominantly cause encephalomyopathies with muscle atrophy and neurodegeneration. However, their impact on other tissues, particularly the gastrointestinal tract, requires further investigation. In a recent report in Nature, Moschandrea et al. used mice deficient in the mitochondrial aminoacyl-tRNA synthetase DARS2 to investigate the role of enterocytic mitochondria in dietary lipid processing and transport. Their work sheds light on the development of gastrointestinal disorders as a result of mitochondrial dysfunction.

SUDS3
Also flagged:Nucleosomechromatinhistonesnucleosomesorganizationhistone
Journal Article 2024-02-27 ✓ 1 Snippet Zülske T, Attou A, Groß L, Hörl D, Harz H, Wedemann G.
In-Text Gene Mentions

linker histones

Show Full Abstract

Recent research highlights the significance of the three-dimensional structure of chromatin in regulating various cellular processes, particularly transcription. This is achieved through dynamic chromatin structures that facilitate long-range contacts and control spatial accessibility. Chromatin consists of DNA and a variety of proteins, of which histones play an essential structural role by forming nucleosomes. Extensive experimental and theoretical research in recent decades has yielded conflicting results about key factors that regulate the spatial structure of chromatin, which remains enigmatic. By using a computer model that allows us to simulate chromatin volumes containing physiological nucleosome concentrations, we investigated whether nucleosome spacing or nucleosome density is fundamental for three-dimensional chromatin accessibility. Unexpectedly, the regularity of the nucleosome spacing is crucial for determining the accessibility of the chromatin network to diffusive processes, whereas variation in nucleosome concentrations has only minor effects. Using only the basic physical properties of DNA and nucleosomes was sufficient to generate chromatin structures consistent with published electron microscopy data. Contrary to other work, we found that nucleosome density did not substantially alter the properties of chromatin fibers or contact probabilities of genomic loci. No breakup of fiber-like structures was observed at high molar density. These findings challenge previous assumptions and highlight the importance of nucleosome spacing as a key driver of chromatin organization. These results identified changes in nucleosome spacing as a tentative mechanism for altering the spatial chromatin structure and thus genomic functions.

TNFSF4
Also flagged:tumorcancersFidgetinFIGNhepatomahepatocellular carcinoma
Journal Article 2024-02-27 ✓ 2 Snippets Qi L, Chen S, Liao Z, Fan M, Zhang J, Gao Y, Shen J, Sun Y, Wang Q.
In-Text Gene Mentions

High expression of CD28 (P=6.83e-06), CD27 (P=0.000), CD244 (P=0.002), PDCD1LG2 (P=0.003), CD86 (P=0.005), and CD48 (P=0.007) was shown in a Kaplan-Meier plot to be substantially linked with a better prognosis for HCC, while high expression of TNFSF4 (P=2.93e-07) and NRP1 (P=0.007) illustrated opposite survival outcome (Figure 6D).

…high expression ofTNFSF4( P =2.93e-07)…

Show Full Abstract

Most cancers have a downregulation of Fidgetin (FIGN), which has been linked to tumor growth. However, there aren't many papers that mention FIGN's connection to hepatocellular carcinoma (HCC). Here, FIGN expression in HCC tissues was markedly reduced as compared to nearby normal liver tissues. According to univariate and multivariate Cox regression, it served as an independent predictor of survival outcomes. Patients with high levels of FIGN expression had a worse outcome. FIGN was shown to be engaged in immune-related pathways and to have a positive correlation with immunological score and immune cells according to KEGG pathway analysis. In HCC patients, FIGN was substantially linked with immunological checkpoints and the hot tumor state. Additionally, immunotherapy and chemotherapy showed a significant therapeutic response in HCC patients with low FIGN expression. This research revealed that FIGN expression was tightly related to hepatoma immunity and might be employed as a biomarker to predict patient prognosis and guide medication.

PTGIS
Also flagged:Pulmonary Arterial HypertensionpolymeraseGDF2BMPR2ATP13A3Pulmonary hypertension
Journal Article 2024-02-27 ✓ 4 Snippets Wang MT, Weng KP, Chang SK, Huang WC, Chen LW.
In-Text Gene Mentions

All quality control-passed variants from the Variant Call Format (VCF) files were further screened using a list of 39 PAH-related genes, including BMPR2 [10], GDF2 [10], ATP13A3 [10], AQP1 [10], ACVRL1 [10], KCNA3 [54], KCNK3 [10], EIF2AK4 [10], KLF2 [10], SMAD1 [10], SMAD4 [10], SMAD9 [10], TBX4 [10], SOX17 [10], CAV1 [10], KCNA5 [10], BMPR1A [30], BMPR1B [30], ENG [6], ABCA3 [9,55], NOTCH1 [56,57], NOTCH2 [58,59], NOTCH3 [46,60], ABCC8 [61,62], BMP10 [42,63], FBLN2 [64], JAG1 [65], JAG2, PTGIS [50], PDGFD [64], GGCX [66], SMAD5 [67,68], KLK1 [66], SARS2 [69], SERPINE1 [61], SIRT3 [70], THBS1 [71], TNIP2 [72], and TopBP1 [57,73].

Furthermore, the PTGIS gene was reported as a causative gene specifically in Chinese patients in [50], and four PAH patients (5.8%) in this study had variants of this gene.

…65 ], JAG2,PTGIS[ 50 ],…

…Furthermore, thePTGISgene was reported…

Show Full Abstract

Asians have a higher carrier rate of pulmonary arterial hypertension (PAH)-related genetic variants than Caucasians do. This study aimed to identify PAH-related genetic variants using whole exome sequencing (WES) in Asian idiopathic and heritable PAH cohorts. A WES library was constructed, and candidate variants were further validated by polymerase chain reaction and Sanger sequencing in the PAH cohort. In a total of 69 patients, the highest incidence of variants was found in the BMPR2, <i>ATP13A3</i>, and <i>GDF2</i> genes. Regarding the <i>BMPR2</i> gene variants, there were two nonsense variants (c.994C>T, p. Arg332*; c.1750C>T, p. Arg584*), one missense variant (c.1478C>T, p. Thr493Ile), and one novel in-frame deletion variant (c.877_888del, p. Leu293_Ser296del). Regarding the <i>GDF2</i> variants, there was one likely pathogenic nonsense variant (c.259C>T, p. Gln87*) and two missense variants (c.1207G>A, p. Val403Ile; c.38T>C, p. Leu13Pro). The <i>BMPR2</i> and <i>GDF2</i> variant subgroups had worse hemodynamics. Moreover, the <i>GDF2</i> variant patients were younger and had a significantly lower GDF2 value (135.6 ± 36.2 pg/mL, <i>p</i> = 0.002) in comparison to the value in the non-<i>BMPR2</i>/non-<i>GDF2</i> mutant group (267.8 ± 185.8 pg/mL). The <i>BMPR2</i> variant carriers had worse hemodynamics compared to the patients with the non-<i>BMPR2</i>/non-<i>GDF2</i> mutant group. Moreover, there was a significantly lower GDF2 value in the <i>GDF2</i> variant carriers compared to the control group. <i>GDF2</i> may be a protective or corrected modifier in certain genetic backgrounds.

POU3F2
Also flagged:Strokecerebral ischemiaacute strokedeathstrokesischemic stroke
Journal Article 2024-02-27 ✓ 1 Snippet Gendosz de Carrillo D, Kocikowska O, Rak M, Krzan A, Student S, Jędrzejowska-Szypułka H, Pawletko K, Lasek-Bal A.
In-Text Gene Mentions

…ONECUT1, ONECUT2, POU2F1,POU3F2, PRTG, REST, SMARCE1,…

Show Full Abstract

Reperfusion stroke therapy is a modern treatment that involves thrombolysis and the mechanical removal of thrombus from the extracranial and/or cerebral arteries, thereby increasing penumbra reperfusion. After reperfusion therapy, 46% of patients are able to live independently 3 months after stroke onset. MicroRNAs (miRNAs) are essential regulators in the development of cerebral ischemia/reperfusion injury and the efficacy of the applied treatment. The first aim of this study was to examine the change in serum miRNA levels via next-generation sequencing (NGS) 10 days after the onset of acute stroke and reperfusion treatment. Next, the predictive values of the bioinformatics analysis of miRNA gene targets for the assessment of brain ischemic response to reperfusion treatment were explored. Human serum samples were collected from patients on days 1 and 10 after stroke onset and reperfusion treatment. The samples were subjected to NGS and then validated using qRT-PCR. Differentially expressed miRNAs (DEmiRNAs) were used for enrichment analysis. Hsa-miR-9-3p and hsa-miR-9-5p expression were downregulated on day 10 compared to reperfusion treatment on day 1 after stroke. The functional analysis of miRNA target genes revealed a strong association between the identified miRNA and stroke-related biological processes related to neuroregeneration signaling pathways. Hsa-miR-9-3p and hsa-miR-9-5p are potential candidates for the further exploration of reperfusion treatment efficacy in stroke patients.

Also flagged:SynthesischromophoresCoumarinscoumarincholinesteraseChalcone
Journal Article 2024-02-27 No Snippets Rohman N, Ardiansah B, Wukirsari T, Judeh Z.
Show Full Abstract

Molecular hybridization represents a new approach in drug discovery in which specific chromophores are strategically combined to create novel drugs with enhanced therapeutic effects. This innovative strategy leverages the strengths of individual chromophores to address complex biological challenges, synergize beneficial properties, optimize pharmacokinetics, and overcome limitations associated with single-agent therapies. Coumarins are documented to possess several bioactivities and have therefore been targeted for combination with other active moieties to create molecular hybrids. This review summarizes recent (2013-2023) trends in the synthesis of coumarins, as well as coumarin-chalcone and coumarin-triazole molecular hybrids. To cover the wide aspects of this area, we have included differently substituted coumarins, chalcones, 1,2,3- and 1,2,4-triazoles in this review and considered the point of fusion/attachment with coumarin to show the diversity of these hybrids. The reported syntheses mainly relied on well-established chemistry without the need for strict reaction conditions and usually produced high yields. Additionally, we discussed the bioactivities of the reported compounds, including antioxidative, antimicrobial, anticancer, antidiabetic, and anti-cholinesterase activities and commented on their IC<sub>50</sub> where possible. Promising bioactivity results have been obtained so far. It is noted that mechanistic studies are infrequently found in the published work, which was also mentioned in this review to give the reader a better understanding. This review aims to provide valuable information to enable further developments in this field.

SOX6
Also flagged:neurogenesisagingbrain tumorparaformaldehydecalcein-AMethidium-homodimer1
Journal Article 2024-02-27 ✓ 1 Snippet Baig S, Nadaf J, Allache R, Le PU, Luo M, Djedid A, Nkili-Meyong A, Safisamghabadi M, Prat A, Antel J, Guiot MC, Petrecca K.
In-Text Gene Mentions

…markers VCAN ,SOX6, PCDH15 ,…

Show Full Abstract

The existence of neural stem cells (NSCs) in adult human brain neurogenic regions remains unresolved. To address this, we created a cell atlas of the adult human subventricular zone (SVZ) derived from fresh neurosurgical samples using single-cell transcriptomics. We discovered 2 adult radial glia (RG)-like populations, aRG1 and aRG2. aRG1 shared features with fetal early RG (eRG) and aRG2 were transcriptomically similar to fetal outer RG (oRG). We also captured early neuronal and oligodendrocytic NSC states. We found that the biological programs driven by their transcriptomes support their roles as early lineage NSCs. Finally, we show that these NSCs have the potential to transition between states and along lineage trajectories. These data reveal that multipotent NSCs reside in the adult human SVZ.

Also flagged:Hydroxyapatiteextracellularnanowiresbariumcollagenbone remodeling
Journal Article 2024-02-27 No Snippets Tavares C, Vieira T, Silva JC, Borges JPMR, Lança MC.
Show Full Abstract

Open-cell foams based on hydroxyapatite (HAp) can mimic the extracellular matrix (ECM) to better replace damaged hard tissues and assist in their regeneration processes. Aerogels of HAp nanowires (NW) with barium titanate (BT) particles were produced and characterized regarding their physical and chemical properties, bioactivity, and in vitro cytotoxicity. Considering the role of piezoelectricity (mainly due to collagen) and surface charges in bone remodeling, all BT particles, of size 280 nm and 2 and 3 µm, contained BaTiO<sub>3</sub> in their piezoelectric tetragonal phase. The synthesized nanowires were verified to be AB-type carbonated hydroxyapatite. The aerogels showed high porosity and relatively homogeneous distribution of the BT particles. Barium titanate proved to be non-cytotoxic while all the aerogels produced were cytotoxic for an extract concentration of 1 mg/mL but became non-cytotoxic at concentrations of 0.5 mg/mL and below. It is possible that these results were affected by the higher surface area and quicker dissolution rate of the aerogels. In the bioactivity assays, SEM/EDS, it was not easy to differentiate between the apatite deposition and the surface of the HAp wires. However, a quantitative EDS analysis shows a possible CaP deposition/dissolution cycle taking place.

DCC
Also flagged:Psychiatric DisordersUNC-5netrin receptoraxonneurodegenerative disordersNTN1
Journal Article 2024-02-27 ✓ 5 Snippets Treccarichi S, Failla P, Vinci M, Musumeci A, Gloria A, Vasta A, Calabrese G, Papa C, Federico C, Saccone S, Calì F.
In-Text Gene Mentions

The NTN1/DCC complex has previously been linked to schizophrenia and neuropsychiatric disorders during adolescence [18,19,20].

…The NTN1/DCCsignaling pathway, interacting…

…in Colorectal Cancer (DCC) and Unc-5 Netrin…

…The NTN1/DCCcomplex has previously…

…another receptor namedDCC.…

Show Full Abstract

The UNC-5 family of netrin receptor genes, predominantly expressed in brain tissues, plays a pivotal role in various neuronal processes. Mutations in genes involved in axon development contribute to a wide spectrum of human diseases, including developmental, neuropsychiatric, and neurodegenerative disorders. The NTN1/DCC signaling pathway, interacting with UNC5C, plays a crucial role in central nervous system axon guidance and has been associated with psychiatric disorders during adolescence in humans. Whole-exome sequencing analysis unveiled two compound heterozygous causative mutations within the <i>UNC5C</i> gene in a patient diagnosed with psychiatric disorders. In silico analysis demonstrated that neither of the observed variants affected the allosteric linkage between UNC5C and NTN1. In fact, these mutations are located within crucial cytoplasmic domains, specifically ZU5 and the region required for the netrin-mediated axon repulsion of neuronal growth cones. These domains play a critical role in forming the supramodular protein structure and directly interact with microtubules, thereby ensuring the functionality of the axon repulsion process. We emphasize that these mutations disrupt the aforementioned processes, thereby associating the <i>UNC5C</i> gene with psychiatric disorders for the first time and expanding the number of genes related to psychiatric disorders. Further research is required to validate the correlation of the <i>UNC5C</i> gene with psychiatric disorders, but we suggest including it in the genetic analysis of patients with psychiatric disorders.

SERPINC1
Also flagged:respiratory diseaselipidinfectionco-infectioncoagulationcomplement component 4
Journal Article 2024-02-27 ✓ 3 Snippets Alvarez I, Ducatez M, Guo Y, Lion A, Widgren A, Dubourdeau M, Baillif V, Saias L, Zohari S, Bergquist J, Meyer G, Valarcher JF, Hägglund S.
In-Text Gene Mentions

…KNG1, PLG, andSERPINC1were found to…

…however, A2M andSERPINC1, which are proteins…

…FGG, KNG1, andSERPINC1) in the M.…

Show Full Abstract

The role of Influenza D virus (IDV) in bovine respiratory disease remains unclear. An in vivo experiment resulted in increased clinical signs, lesions, and pathogen replication in calves co-infected with IDV and <i>Mycoplasma bovis</i> (<i>M</i>. <i>bovis</i>), compared to single-infected calves. The present study aimed to elucidate the host-pathogen interactions and profile the kinetics of lipid mediators in the airways of these calves. Bronchoalveolar lavage (BAL) samples collected at 2 days post-infection (dpi) were used for proteomic analyses by liquid chromatography-tandem mass spectrometry (LC-MS/MS). Additionally, lipidomic analyses were performed by LC-MS/MS on BAL samples collected at 2, 7 and 14 dpi. Whereas <i>M. bovis</i> induced the expression of proteins involved in fibrin formation, IDV co-infection counteracted this coagulation mechanism and downregulated other acute-phase response proteins, such as complement component 4 (C4) and plasminogen (PLG). The reduced inflammatory response against <i>M. bovis</i> likely resulted in increased <i>M. bovis</i> replication and delayed <i>M. bovis</i> clearance, which led to a significantly increased abundance of oxylipids in co-infected calves. The identified induced oxylipids mainly derived from arachidonic acid; were likely oxidized by COX-1, COX-2, and LOX-5; and peaked at 7 dpi. This paper presents the first characterization of BAL proteome and lipid mediator kinetics in response to IDV and <i>M. bovis</i> infection in cattle and raises hypotheses regarding how IDV acts as a co-pathogen in bovine respiratory disease.

Also flagged:KMT2Aleukemia
Journal Article 2024-02-27 No Snippets Unknown Authors
Show Full Abstract

No abstract available.

Preprints.org 2024-02-27 Preprint (No Snippets API) Chiba T.
Show Full Abstract

In 2022, the new WHO Classification of Endocrine and Neuroendocrine Tumors, Fifth Edition (beta version) (WHO 5th) was published. The importance of understanding the molecular genetics of thyroid tumors as revealed by large-scale genomic analyses such as The Cancer Genome Atlas (TCGA). Consequently, the WHO 5th was fundamentally revised, resulting in a systematic classification based on tumor cell-of-origin and clinical risk. This paper outlines following critical points of the WHO 5th. 1. Genetic mutations in follicular cell-derived neoplasms (FDN) highlight the role of mutations in the MAP kinase pathway, including RET, RAS, and BRAF, as drivers of carcinogenesis. Differentiated thyroid cancers such as follicular thyroid carcinoma (FTC) and papillary thyroid carcinoma (PTC) have specific genetic alterations that correlate with morphological classifications: RAS-like tumors (RLTs) and BRAF p.V600E-like tumors (BLTs), respectively. 2. The Framework for benign lesions have revised. The WHO 5th introduces new categories such as &quot;developmental abnormalities&quot; and &quot;thyroid follicular nodular disease&quot; in benign FDN. 3. Low-Risk Tumors include NIFTP, TT-UMP, and HTT. 4. PTC histological variants are reclassified as &quot;subtypes&quot; in the WHO 5th. 5. The concept of high-grade carcinomas is introduced, encompassing poorly differentiated thyroid carcinoma (PDTC), differentiated high-grade thyroid carcinoma (DHGTC), and high-grade medullary thyroid carcinoma (MTC). 6. Squamous cell carcinoma is included in anaplastic thyroid carcinoma (ATC) in the WHO 5th due to shared genetic and prognostic features. 7. Hürthle cell adenoma/carcinoma is renamed oncocytic thyroid adenoma/carcinoma. 8. Other miscellaneous tumors are classified into salivary gland-type carcinomas of the thyroid, thyroid tumours of uncertain histogenesis, thymic tumours within the thyroid, and embryonal thyroid neoplasms. The WHO 5th thus emphasizes the importance of classifying tumors based on genetic abnormalities together with histomorphology, aiding in accurate pathological diagnosis and treatment selection, including molecular-targeted therapies.

SOX6
Also flagged:organizationautophagyphagocytosisinfectionneurodegenerative diseaseimmune response
Journal Article 2024-02-26 ✓ 1 Snippet Feng M, Fei S, Zou J, Xia J, Lai W, Huang Y, Swevers L, Sun J.
In-Text Gene Mentions

…DEGs LIM/Lhx1 (BMSK0009315),sox6(BMSK0008039), sox1a (BMSK0001…

Show Full Abstract

<h4>Introduction</h4>The brain is considered as an immune-privileged organ, yet innate immune reactions can occur in the central nervous system of vertebrates and invertebrates. Silkworm (Bombyx mori) is an economically important insect and a lepidopteran model species. The diversity of cell types in the silkworm brain, and how these cell subsets produce an immune response to virus infection, remains largely unknown.<h4>Methods</h4>Single-nucleus RNA sequencing (snRNA-seq), bioinformatics analysis, RNAi, and other methods were mainly used to analyze the cell types and gene functions of the silkworm brain.<h4>Results</h4>We used snRNA-seq to identify 19 distinct clusters representing Kenyon cell, glial cell, olfactory projection neuron, optic lobes neuron, hemocyte-like cell, and muscle cell types in the B. mori nucleopolyhedrovirus (BmNPV)-infected and BmNPV-uninfected silkworm larvae brain at the late stage of infection. Further, we found that the cell subset that exerts an antiviral function in the silkworm larvae brain corresponds to hemocytes. Specifically, antimicrobial peptides were significantly induced by BmNPV infection in the hemocytes, especially lysozyme, exerting antiviral effects.<h4>Conclusion</h4>Our single-cell dataset reveals the diversity of silkworm larvae brain cells, and the transcriptome analysis provides insights into the immune response following virus infection at the single-cell level.

SLC2A14
Also flagged:PLD2cancerOCovarian cancerHIF-1αAP-1
Journal Article 2024-02-26 ✓ 1 Snippet Muñoz-Galván S, Verdugo-Sivianes EM, Santos-Pereira JM, Estevez-García P, Carnero A.
In-Text Gene Mentions

…nonsignificant increase inSLC2A14( GLUT14 )…

Show Full Abstract

<h4>Background</h4>Hypoxia in solid tumors is an important source of chemoresistance that can determine poor patient prognosis. Such chemoresistance relies on the presence of cancer stem cells (CSCs), and hypoxia promotes their generation through transcriptional activation by HIF transcription factors.<h4>Methods</h4>We used ovarian cancer (OC) cell lines, xenograft models, OC patient samples, transcriptional databases, induced pluripotent stem cells (iPSCs) and Assay for Transposase-Accessible Chromatin using sequencing (ATAC-seq).<h4>Results</h4>Here, we show that hypoxia induces CSC formation and chemoresistance in ovarian cancer through transcriptional activation of the PLD2 gene. Mechanistically, HIF-1α activates PLD2 transcription through hypoxia response elements, and both hypoxia and PLD2 overexpression lead to increased accessibility around stemness genes, detected by ATAC-seq, at sites bound by AP-1 transcription factors. This in turn provokes a rewiring of stemness genes, including the overexpression of SOX2, SOX9 or NOTCH1. PLD2 overexpression also leads to decreased patient survival, enhanced tumor growth and CSC formation, and increased iPSCs reprograming, confirming its role in dedifferentiation to a stem-like phenotype. Importantly, hypoxia-induced stemness is dependent on PLD2 expression, demonstrating that PLD2 is a major determinant of de-differentiation of ovarian cancer cells to stem-like cells in hypoxic conditions. Finally, we demonstrate that high PLD2 expression increases chemoresistance to cisplatin and carboplatin treatments, both in vitro and in vivo, while its pharmacological inhibition restores sensitivity.<h4>Conclusions</h4>Altogether, our work highlights the importance of the HIF-1α-PLD2 axis for CSC generation and chemoresistance in OC and proposes an alternative treatment for patients with high PLD2 expression.

HFE
Also flagged:metabolismcefiderocolInfectionsIronHematomadeferiprone
Journal Article 2024-02-26 ✓ 1 Snippet Ding J, Wang X, Liu W, Ding C, Wu J, He R, Zhang X.
In-Text Gene Mentions

…diseases such ashemochromatosisand thalassemia.…

Show Full Abstract

Hematoma, a risk factor of implant-associated infections (IAIs), creates a Fe-rich environment following implantation, which proliferates the growth of pathogenic bacteria. Fe metabolism is a major vulnerability for pathogens and is crucial for several fundamental physiological processes. Herein, a deferiprone (DFP)-loaded layered double hydroxide (LDH)-based nanomedicine (DFP@Ga-LDH) that targets the Fe-rich environments of IAIs is reported. In response to acidic changes at the infection site, DFP@Ga-LDH systematically interferes with bacterial Fe metabolism via the substitution of Ga<sup>3+</sup> and Fe scavenging by DFP. DFP@Ga-LDH effectively reverses the Fe/Ga ratio in Pseudomonas aeruginosa, causing comprehensive interference in various Fe-associated targets, including transcription and substance metabolism. In addition to its favorable antibacterial properties, DFP@Ga-LDH functions as a nano-adjuvant capable of delaying the emergence of antibiotic resistance. Accordingly, DFP@Ga-LDH is loaded with a siderophore antibiotic (cefiderocol, Cefi) to achieve the antibacterial nanodrug DFP@Ga-LDH-Cefi. Antimicrobial and biosafety efficacies of DFP@Ga-LDH-Cefi are validated using ex vivo human skin and mouse IAI models. The pivotal role of the hematoma-created Fe-rich environment of IAIs is highlighted, and a nanoplatform that efficiently interferes with bacterial Fe metabolism is developed. The findings of the study provide promising guidance for future research on the exploration of nano-adjuvants as antibacterial agents.

SUDS3
Also flagged:Protaminesnuclear basic proteinsacetic acidureadegradationarginine
Journal Article 2024-02-26 ✓ 1 Snippet Leyden MR, Gowen B, Gonzalez-Romero R, Eirin-Lopez JM, Kim BH, Hayashi F, McCartney J, Zhang PC, Kubo-Irie M, Shabanowitz J, Hunt DF, Ferree P, Kasinsky H, Ausió J.
In-Text Gene Mentions

…For instance, vertebratelinker histoneshistones (histones of…

Show Full Abstract

Insects are the largest group of animals when it comes to the number and diversity of species. Yet, with the exception of <i>Drosophila</i>, no information is currently available on the primary structure of their sperm nuclear basic proteins (SNBPs). This paper represents the first attempt in this regard and provides information about six species of Neoptera: <i>Poecillimon thessalicus, Graptosaltria nigrofuscata, Apis mellifera, Nasonia vitripennis, Parachauliodes continentalis</i>, and <i>Tribolium castaneum</i>. The SNBPs of these species were characterized by acetic acid urea gel electrophoresis (AU-PAGE) and high-performance liquid chromatography fractionated. Protein sequencing was obtained using a combination of mass spectrometry sequencing, Edman N-terminal degradation sequencing and genome mining. While the SNBPs of several of these species exhibit a canonical arginine-rich protamine nature, a few of them exhibit a protamine-like composition. They appear to be the products of extensive cleavage processing from a precursor protein which are sometimes further processed by other post-translational modifications that are likely involved in the chromatin transitions observed during spermiogenesis in these organisms.

SERPINC1
Also flagged:Nephrotic syndromeNSrenal diseaseshypoproteinemiahyperlipidemiapathogenesis
Journal Article 2024-02-26 ✓ 2 Snippets Wang Z, Wang N, Chen R, Tang H, Lin Q, Li X.
In-Text Gene Mentions

…including antithrombin III (ATIII), protein C, protein…

…, 28 ],ATIII< 80% […

Show Full Abstract

<h4>Objective</h4>To analyze the clinical effect of urokinase on the prevention of thrombosis in children with primary nephrotic syndrome.<h4>Methods</h4>A total of 370 children diagnosed with primary nephrotic syndrome (PNS) in the Children's Hospital of Soochow University and Zibo Maternal and Child Health Hospital from January 2018 to December 2022 were selected as the research objects. The patients were divided into a urokinase adjuvant therapy group and non-urokinase adjuvant therapy group according to the application of drugs. The clinical data of the children were collected, including sex, age, drug application, bleeding during treatment, and telephone follow-up, to record whether thromboembolism occurred in the acute stage and remission stage. The clinical pattern of PNS, renal biopsy, histopathological type, and related laboratory indexes before and after treatment were recorded.<h4>Results</h4>A total of 313 patients were treated with urokinase and 57 patients were not. More thrombotic events was observed in non-urokinase group compared to the urokinase group(2 versus 0 episodes, p = 0.02). The thrombotic events observed included one patient had pulmonary embolism combined with right ventricular thrombosis, and another had intracranial venous thrombosis. More minor bleeding events occurred in urokinase group compared to the non-urokinase group(7 versus 1 episodes, p = 1.0). No major bleeding events occurred in either group.<h4>Conclusion</h4>The rational prophylactic use of urokinase anticoagulation in children with PNS can prevent the formation of thromboembolism and has good safety.

POU3F2ZNF664
Also flagged:organizationgene expressionPARM1cognitionautismattention disorder
Journal Article 2024-02-26 ✓ 2 Snippets Yang F, Zhao Z, Zhang D, Xiong Y, Dong X, Wang Y, Yang M, Pan T, Liu C, Liu K, Lin Y, Liu Y, Tu Q, Dang Y, Xia M, Mi D, Zhou W, Xu Z.
In-Text Gene Mentions

…NR2F2 andZNF664might also be…

…the Lhx9 +Pou3f2+ interposed nucleus…

Show Full Abstract

Human cerebellum encompasses numerous neurons, exhibiting a distinct developmental paradigm from cerebrum. Here we conducted scRNA-seq, scATAC-seq and spatial transcriptomic analyses of fetal samples from gestational week (GW) 13 to 18 to explore the emergence of cellular diversity and developmental programs in the developing human cerebellum. We identified transitory granule cell progenitors that are conserved across species. Special patterns in both granule cells and Purkinje cells were dissected multidimensionally. Species-specific gene expression patterns of cerebellar lobes were characterized and we found that PARM1 exhibited inconsistent distribution in human and mouse granule cells. A novel cluster of potential neuroepithelium at the rhombic lip was identified. We also resolved various subtypes of Purkinje cells and unipolar brush cells and revealed gene regulatory networks controlling their diversification. Therefore, our study offers a valuable multi-omics landscape of human fetal cerebellum and advances our understanding of development and spatial organization of human cerebellum.

DCC
Also flagged:neurogenesisautismautism spectrum disorderidiopathic autismneurodevelopmental disorderscell proliferation
Journal Article 2024-02-26 ✓ 2 Snippets Barón-Mendoza I, Mejía-Hernández M, Hernández-Mercado K, Guzmán-Condado J, Zepeda A, González-Arenas A.
In-Text Gene Mentions

…neurogenesis ( Cacna1c,Dcc, Tpo, Esr2, Nefh,…

…neurons ( Disc1,Dcc, Slc6a4, Tpo, Dnmt1,…

Show Full Abstract

Individuals with autism spectrum disorder (ASD) often exhibit atypical hippocampal anatomy and connectivity throughout their lifespan, potentially linked to alterations in the neurogenic process within the hippocampus. In this study, we performed an in-silico analysis to identify single-nucleotide polymorphisms (SNPs) in genes relevant to adult neurogenesis in the C58/J model of idiopathic autism. We found coding non-synonymous (Cn) SNPs in 33 genes involved in the adult neurogenic process, as well as in 142 genes associated with the signature genetic profile of neural stem cells (NSC) and neural progenitors. Based on the potential alterations in adult neurogenesis predicted by the in-silico analysis, we evaluated the number and distribution of newborn neurons in the dentate gyrus (DG) of young adult C58/J mice. We found a reduced number of newborn cells in the whole DG, a higher proportion of early neuroblasts in the subgranular layer (SGZ), and a lower proportion of neuroblasts with morphological maturation signs in the granule cell layer (GCL) of the DG compared to C57BL/6J mice. The observed changes may be associated with a delay in the maturation trajectory of newborn neurons in the C58/J strain, linked to the Cn SNPs in genes involved in adult hippocampal neurogenesis.

ARFGEF2
Also flagged:cancersovarian cancerprostate cancercancergene expressionpolyadenylation
Journal Article 2024-02-26 ✓ 2 Snippets Chen H, Wang Z, Gong L, Wang Q, Chen W, Wang J, Ma X, Ding R, Li X, Zou X, Plass M, Lian C, Ni T, Wei GH, Li W, Deng L, Li L.
In-Text Gene Mentions

Notably, we identified 60 genes with well-established role in cancer biology, such as for breast cancer (BAZ3A, DNAJA1, SMU1, CDK12, KANSL1, SLC4A7, L3MBTL3, MRTFA, NF1, VEZT, SIN3A, AKAP9, TAF1B, NFIX, MEPCE, CHD3, CASP8, TRIOBP), for basal cell carcinoma (EIF2S2, VMP1), for cervical (PAX8, CDK12, ERBB2, PNISR), for colorectal (SMARCD1, ARFGEF2, LTBP2, CNOT9, PREX1), for female genital organs (SRSF3, TKT, SH3PXD2A, VPS37B, HRAS, DNAJB12), for lung cancer (POLR1A, TBC1D2B), for lymphoma cancer (POLR1A), for male genital organs (KANSL1, USP36, CRKL), for ovarian cancer (KANSL1), for prostate cancer (SEC62, CCND3, SOD2, AXL, RPRD1, ZBTB7B, NUCKS1, POLR1A, WTAP, TAF1B, FLT3LG, BCL2L12, SMAD2, POGZ, RPS19, KANSL1, NCOA4, ZBTB16, CTBP2, EIF3E, GATA2, SETDB1, IGMBP2, RAPGEF3) and skin cancer (ZBTB7B, ANKRD11, KANSL1, RPRD2, CASP8, SMARCD1).

…( SMARCD1 ,ARFGEF2, LTBP2 ,…

Show Full Abstract

Alternative polyadenylation plays an important role in cancer initiation and progression; however, current transcriptome-wide association studies mostly ignore alternative polyadenylation when identifying putative cancer susceptibility genes. Here, we perform a pan-cancer 3' untranslated region alternative polyadenylation transcriptome-wide association analysis by integrating 55 well-powered (n > 50,000) genome-wide association studies datasets across 22 major cancer types with alternative polyadenylation quantification from 23,955 RNA sequencing samples across 7,574 individuals. We find that genetic variants associated with alternative polyadenylation are co-localized with 28.57% of cancer loci and contribute a significant portion of cancer heritability. We further identify 642 significant cancer susceptibility genes predicted to modulate cancer risk via alternative polyadenylation, 62.46% of which have been overlooked by traditional expression- and splicing- studies. As proof of principle validation, we show that alternative alleles facilitate 3' untranslated region lengthening of CRLS1 gene leading to increased protein abundance and promoted proliferation of breast cancer cells. Together, our study highlights the significant role of alternative polyadenylation in discovering new cancer susceptibility genes and provides a strong foundational framework for enhancing our understanding of the etiology underlying human cancers.

HTT
Also flagged:genetic disordersnucleotidegenetic disorderdevelopmental delayintellectual disabilitygenetic disease
Journal Article 2024-02-26 ✓ 1 Snippet Wigby KM, Brockman D, Costain G, Hale C, Taylor SL, Belmont J, Bick D, Dimmock D, Fernbach S, Greally J, Jobanputra V, Kulkarni S, Spiteri E, Taft RJ.
In-Text Gene Mentions

Examples of targeted genetic testing include single or limited panel of genes for a specific disorder, such as FGFR3 genotyping for achondroplasia, karyotype for suspected Trisomy 21, repeat expansion testing of HTT for Huntington’s disease, panels for non-syndromic retinitis pigmentosa or hypertrophic cardiomyopathy.

Show Full Abstract

Early use of genome sequencing (GS) in the diagnostic odyssey can reduce suffering and improve care, but questions remain about which patient populations are most amenable to GS as a first-line diagnostic test. To address this, the Medical Genome Initiative conducted a literature review to identify appropriate clinical indications for GS. Studies published from January 2011 to August 2022 that reported on the diagnostic yield (DY) or clinical utility of GS were included. An exploratory meta-analysis using a random effects model evaluated DY based on cohort size and diagnosed cases per cohort. Seventy-one studies met inclusion criteria, comprising over 13,000 patients who received GS in one of the following settings: hospitalized pediatric patients, pediatric outpatients, adult outpatients, or mixed. GS was the first-line test in 38% (27/71). The unweighted mean DY of first-line GS was 45% (12-73%), 33% (6-86%) in cohorts with prior genetic testing, and 33% (9-60%) in exome-negative cohorts. Clinical utility was reported in 81% of first-line GS studies in hospitalized pediatric patients. Changes in management varied by cohort and underlying molecular diagnosis (24-100%). To develop evidence-informed points to consider, the quality of all 71 studies was assessed using modified American College of Radiology (ACR) criteria, with five core points to consider developed, including recommendations for use of GS in the N/PICU, in lieu of sequential testing and when disorders with substantial allelic heterogeneity are suspected. Future large and controlled studies in the pediatric and adult populations may support further refinement of these recommendations.

ZNFX1
Also flagged:Interferonstype 1 diabetesIFN-αIFN-γIL-1βTNF-α
Journal Article 2024-02-26 ✓ 2 Snippets Coomans de Brachène A, Alvelos MI, Szymczak F, Zimath PL, Castela A, Marmontel de Souza B, Roca Rivada A, Marín-Cañas S, Yi X, Op de Beeck A, Morgan NG, Sonntag S, Jawurek S, Title AC, Yesildag B, Pattou F, Kerr-Conte J, Montanya E, Nacher M, Marselli L, Marchetti P, Richardson SJ, Eizirik DL.
In-Text Gene Mentions

Zinc finger NFX1-type containing 1 (ZNFX1), a double-stranded RNA sensor, was identified as highly induced by IFNs and shown to play a key role in the antiviral response in beta cells.<h4>Conclusions/interpretation</h4>These data suggest that IFN-α and IFN-γ are key cytokines at the islet level in human type 1 diabetes, contributing to the triggering and amplification of autoimmunity.

…NFX1-type containing 1 (ZNFX1), a double-stranded RNA…

Show Full Abstract

<h4>Aims/hypothesis</h4>The proinflammatory cytokines IFN-α, IFN-γ, IL-1β and TNF-α may contribute to innate and adaptive immune responses during insulitis in type 1 diabetes and therefore represent attractive therapeutic targets to protect beta cells. However, the specific role of each of these cytokines individually on pancreatic beta cells remains unknown.<h4>Methods</h4>We used deep RNA-seq analysis, followed by extensive confirmation experiments based on reverse transcription-quantitative PCR (RT-qPCR), western blot, histology and use of siRNAs, to characterise the response of human pancreatic beta cells to each cytokine individually and compared the signatures obtained with those present in islets of individuals affected by type 1 diabetes.<h4>Results</h4>IFN-α and IFN-γ had a greater impact on the beta cell transcriptome when compared with IL-1β and TNF-α. The IFN-induced gene signatures have a strong correlation with those observed in beta cells from individuals with type 1 diabetes, and the level of expression of specific IFN-stimulated genes is positively correlated with proteins present in islets of these individuals, regulating beta cell responses to 'danger signals' such as viral infections. Zinc finger NFX1-type containing 1 (ZNFX1), a double-stranded RNA sensor, was identified as highly induced by IFNs and shown to play a key role in the antiviral response in beta cells.<h4>Conclusions/interpretation</h4>These data suggest that IFN-α and IFN-γ are key cytokines at the islet level in human type 1 diabetes, contributing to the triggering and amplification of autoimmunity.

Also flagged:cationcationsporewaterAMPA receptorbinding
Journal Article 2024-02-26 No Snippets Nakagawa T, Wang XT, Miguez-Cabello FJ, Bowie D.
Show Full Abstract

Alpha-amino-3-hydroxyl-5-methyl-4-isoxazole-propionic acid receptors (AMPARs) are cation-selective ion channels that mediate most fast excitatory neurotransmission in the brain. Although their gating mechanism has been studied extensively, understanding how cations traverse the pore has remained elusive. Here we investigated putative ion and water densities in the open pore of Ca<sup>2+</sup>-permeable AMPARs (rat GRIA2 flip-Q isoform) at 2.3-2.6 Å resolution. We show that the ion permeation pathway attains an extracellular Ca<sup>2+</sup> binding site (site-G) when the channel gate moves into the open configuration. Site-G is highly selective for Ca<sup>2+</sup> over Na<sup>+</sup>, favoring the movement of Ca<sup>2+</sup> into the selectivity filter of the pore. Seizure-related N619K mutation, adjacent to site-G, promotes channel opening but attenuates Ca<sup>2+</sup> binding and thus diminishes Ca<sup>2+</sup> permeability. Our work identifies the importance of site-G, which coordinates with the Q/R site of the selectivity filter to ensure the preferential transport of Ca<sup>2+</sup> through the channel pore.

ARFGEF2
Also flagged:thyroid cancerstumorthyroid canceranaplastic thyroid carcinomasanaplastic thyroid cancerthyroid carcinomas
Journal Article 2024-02-26 ✓ 1 Snippet Zeng PYF, Prokopec SD, Lai SY, Pinto N, Chan-Seng-Yue MA, Clifton-Bligh R, Williams MD, Howlett CJ, Plantinga P, Cecchini MJ, Lam AK, Siddiqui I, Wang J, Sun RX, Watson JD, Korah R, Carling T, Agrawal N, Cipriani N, Ball D, Nelkin B, Rooper LM, Bishop JA, Garnis C, Berean K, Nicolson NG, Weinberger P, Henderson YC, Lalansingh CM, Tian M, Yamaguchi TN, Livingstone J, Salcedo A, Patel K, Vizeacoumar F, Datti A, Xi L, Nikiforov YE, Smallridge R, Copland JA, Marlow LA, Hyrcza MD, Delbridge L, Sidhu S, Sywak M, Robinson B, Fung K, Ghasemi F, Kwan K, MacNeil SD, Mendez A, Palma DA, Khan MI, Shaikh M, Ruicci KM, Wehrli B, Winquist E, Yoo J, Mymryk JS, Rocco JW, Wheeler D, Scherer S, Giordano TJ, Barrett JW, Faquin WC, Gill AJ, Clayman G, Boutros PC, Nichols AC.
In-Text Gene Mentions

…genes, for example,ARFGEF2, CHD6 ,…

Show Full Abstract

Anaplastic thyroid carcinoma is arguably the most lethal human malignancy. It often co-occurs with differentiated thyroid cancers, yet the molecular origins of its aggressivity are unknown. We sequenced tumor DNA from 329 regions of thyroid cancer, including 213 from patients with primary anaplastic thyroid carcinomas. We also whole genome sequenced 9 patients using multi-region sequencing of both differentiated and anaplastic thyroid cancer components. Using these data, we demonstrate thatanaplastic thyroid carcinomas have a higher burden of mutations than other thyroid cancers, with distinct mutational signatures and molecular subtypes. Further, different cancer driver genes are mutated in anaplastic and differentiated thyroid carcinomas, even those arising in a single patient. Finally, we unambiguously demonstrate that anaplastic thyroid carcinomas share a genomic origin with co-occurring differentiated carcinomas and emerge from a common malignant field through acquisition of characteristic clonal driver mutations.

DCC
Also flagged:PhenolFlavonoidphenolic compoundsmethanolethylacetate
Journal Article 2024-02-26 ✓ 1 Snippet El Kamari F, El Omari H, El-Mouhdi K, Chlouchi A, Harmouzi A, Lhilali I, El Amrani J, Zahouani C, Hajji Z, Ousaaid D.
In-Text Gene Mentions

…Antifungal Activities ofMicromeria graeca L .graeca L .…

Show Full Abstract

<i>Micromeria graeca</i> L. is a dense chemical source of bioactive compounds such as phenolic compounds, which have various health-related properties. The current study aimed to investigate the impact of different extractor solvents on phenol and flavonoid contents, as well as the antioxidant and antifungal activities of different extracts. Initially, three extractor solvents (methanol, ethyl acetate, and water) were used to prepare the Soxhlet extracts, which were then examined for their polyphenolic content, flavonoid content, and antioxidant potential using three complementary assays (DPPH, FRAP, and TAC). The antifungal capacity against the two fungal strains (<i>Candida albicans</i> and <i>Aspergillus niger</i>) was performed using the method of diffusion on disc. The dosage of phytochemical compounds revealed that the highest values were established in water extract with values of 360 ± 22.1 mg GAE/g dry weight plant and 81.3 ± 21.2 mg RE/g dry weight plant for TPC and TFC, respectively. In addition, the strongest antioxidant activity measured by DPPH and FRAP assays was established in water extract with IC<sub>50</sub> values of 0.33 ± 0.23 and 0.23 ± 0.12 mg/mL, respectively, while the methanol extract showed the best antioxidant activity as measured by TAC with an IC<sub>50</sub> of 483 ± 17.6 mg GAEq/g dry weight plant. The water extract recorded the most important antifungal activity against <i>Candida albicans</i> with an inhibition zone of 16 ± 1.6 mm and MFC = 500 <i>μ</i>g/mL, whereas ethyl acetate extract showed the lowest activity against both studied fungi strains. <i>Micromeria graeca</i> L. contains considerable amounts of bioactive contents with high antioxidant and antifungal potentials, which may make it a promising source of antioxidants and natural antifungal agents.

Also flagged:erythropoiesisβ-thalassemiahereditary disorderhemolytic anemiaoxygeniron
Journal Article 2024-02-26 No Snippets Lin S, Zheng Y, Chen M, Xu L, Huang H.
Show Full Abstract

In Guangxi, Hainan, and Fujian Province in southern China, β-thalassemia is a frequent monogenic hereditary disorder that is primarily defined by hemolytic anemia brought on by inefficient erythropoiesis. It has been found that ineffective erythropoiesis in β-thalassemia is closely associated with a high accumulation of Reactive oxygen species, a product of oxidative stress, in erythroid cells. During recent years, ferroptosis is an iron-dependent lipid peroxidation that involves abnormalities in lipid and iron metabolism as well as reactive oxygen species homeostasis. It is a recently identified kind of programmed cell death. β-thalassemia patients experience increased iron release from reticuloendothelial cells and intestinal absorption of iron, ultimately resulting in iron overload. Additionally, the secretion of Hepcidin is inhibited in these patients. What counts is both ineffective erythropoiesis and ferroptosis in β-thalassemia are intricately linked to the iron metabolism and Reactive oxygen species homeostasis. Consequently, to shed further light on the pathophysiology of β-thalassemia and propose fresh ideas for its therapy, this paper reviews ferroptosis, ineffective erythropoiesis, and the way they interact.

STAU1
Also flagged:wound healingVIMSMAD5LINC02581keratinocyte migrationskin injury
Journal Article 2024-02-26 ✓ 1 Snippet Xiao Y, Zhang C, Liu X, Yang Y, Landén NX, Zhang Z, Li D.
In-Text Gene Mentions

…binds to theSTAU1protein to stabilize…

Show Full Abstract

<h4>Objectives</h4>Re-epithelialization is an important physiological process for repairing skin barrier function during wound healing. It is primarily mediated by coordinated migration, proliferation, and differentiation of keratinocytes. Long noncoding RNAs (lncRNAs) are essential components of the noncoding genome and participate in various biological processes; however, their expression profiles and function in re-epithelialization during wound healing have not been established.<h4>Methods</h4>We investigated the distribution of lncRNAs during wound re-epithelialization by comparing the genomic profiles of uninjured skin and acute wound (AW) from healthy donors. We performed functional screening of differentially expressed lncRNAs to identify the important lncRNAs for re-epithelialization.<h4>Results</h4>The expression of multiple lncRNAs is changed during human wound re-epithelialization process. We identified VIM-AS1, SMAD5-AS1, and LINC02581 as critical regulators involved in keratinocyte migration, proliferation, and differentiation, respectively.<h4>Conclusion</h4>LncRNAs play crucial regulatory roles in wound re-epithelialization. We established lncRNA expression profile in human acute wounds compared with intact skin, offering valuable insights into the physiological mechanisms underlying wound healing and potential therapeutic targets.

Also flagged:chromosomeamyotrophic lateral sclerosisALSfrontotemporal dementiagene expressionautophagy
Journal Article 2024-02-26 No Snippets Broce IJ, Sirkis DW, Nillo RM, Bonham LW, Lee SE, Miller BL, Castruita PA, Sturm VE, Sugrue LS, Desikan RS, Yokoyama JS.
Show Full Abstract

<h4>Introduction</h4>A hexanucleotide repeat expansion (HRE) intronic to chromosome 9 open reading frame 72 (<i>C9orf72</i>) is recognized as the most common genetic cause of amyotrophic lateral sclerosis (ALS), frontotemporal dementia (FTD), and ALS-FTD. Identifying genes that show similar regional co-expression patterns to <i>C9orf72</i> may help identify novel gene targets and biological mechanisms that mediate selective vulnerability to ALS and FTD pathogenesis.<h4>Methods</h4>We leveraged mRNA expression data in healthy brain from the Allen Human Brain Atlas to evaluate <i>C9orf72</i> co-expression patterns. To do this, we correlated average <i>C9orf72</i> expression values in 51 regions across different anatomical divisions (cortex, subcortex, and cerebellum) with average gene expression values for 15,633 protein-coding genes, including 54 genes known to be associated with ALS, FTD, or ALS-FTD. We then performed imaging transcriptomic analyses to evaluate whether the identified <i>C9orf72</i> co-expressed genes correlated with patterns of cortical thickness in symptomatic <i>C9orf72</i> pathogenic HRE carriers (<i>n</i> = 19) compared to controls (<i>n</i> = 23). Lastly, we explored whether genes with significant <i>C9orf72</i> imaging transcriptomic correlations (i.e., "<i>C9orf72</i> imaging transcriptomic network") were enriched in specific cell populations in the brain and enriched for specific biological and molecular pathways.<h4>Results</h4>A total of 2,120 genes showed an anatomical distribution of gene expression in the brain similar to <i>C9orf72</i> and significantly correlated with patterns of cortical thickness in <i>C9orf72</i> HRE carriers. This <i>C9orf72</i> imaging transcriptomic network was differentially expressed in cell populations previously implicated in ALS and FTD, including layer 5b cells, cholinergic neurons in the spinal cord and brainstem and medium spiny neurons of the striatum, and was enriched for biological and molecular pathways associated with protein ubiquitination, autophagy, cellular response to DNA damage, endoplasmic reticulum to Golgi vesicle-mediated transport, among others.<h4>Conclusion</h4>Considered together, we identified a network of <i>C9orf72</i> associated genes that may influence selective regional and cell-type-specific vulnerabilities in ALS/FTD.

SERPINC1
Also flagged:ADAMTS-13ThrombosisPortal vein thrombosisliver cirrhosisavon Willebrand factor
Journal Article 2024-02-26 ✓ 5 Snippets Suzuki J, Namisaki T, Takya H, Kaji K, Nishimura N, Shibamoto A, Asada S, Kubo T, Iwai S, Tomooka F, Takeda S, Koizumi A, Tanaka M, Matsuda T, Inoue T, Fujimoto Y, Tsuji Y, Fujinaga Y, Sato S, Kitagawa K, Kawaratani H, Akahane T, Mitoro A, Matsumoto M, Asada K, Yoshiji H.
In-Text Gene Mentions

…A low plasmaATIIIlevel is considered…

…19 ], sinceATIIIadministration is beneficial…

…for those withATIIIof <70% […

…TheATIIIagent is recommended…

…serum level ofATIII(≤70%).…

Show Full Abstract

Portal vein thrombosis (PVT), one of the most prevalent hepatic vascular conditions in patients with liver cirrhosis (LC), is associated with high mortality rates. An imbalance between a disintegrin-like metalloproteinase with thrombospondin type-1 motifs 13 (ADAMTS-13) enzyme and von Willebrand factor (VWF) is responsible for hypercoagulability, including spontaneous thrombus formation in blood vessels. Herein, we aimed to identify potential prognostic and diagnostic biomarkers in Japanese patients with LC and PVT. In total, 345 patients were divided into two groups: 40 patients who developed PVT (PVT group) and 305 who did not develop PVT (NPVT group). Among the 345 patients with LC, 81% (279/345) were deemed ineligible due to the presence of preventive comorbidities, active or recent malignancies, and organ dysfunction. The remaining 66 patients were divided into two groups: the PVT group (n = 33) and the NPVT group (n = 33). Plasma ADAMTS-13 activity (ADAMTS-13:AC) and the vWF antigen (VWF:Ag) were measured using enzyme-linked immunosorbent assays. Contrast-enhanced, three-dimensional helical computed tomography (CT) was used to detect and characterize PVT. ADAMTS-13:AC was significantly lower in the PVT group than in the NPVT group. No significant differences in plasma vWF:Ag or liver stiffness were observed between the two groups. ADAMTS-13:AC of <18.8 was an independent risk factor for PVT on multivariate analyses (odds ratio: 1.67, 95% confidence interval: 1.21-3.00, <i>p</i> < 0.002). The receiver operating characteristic analysis of ADAMTS-13:AC revealed an area under the curve of 0.913 in PVT detection. Patients with PVT having ADAMTS-13:AC ≥18.8 (n = 17) had higher albumin levels and better prognoses than those with ADAMTS-13:AC <18.8 (n = 16). No significant correlations of ADAMTS-13:AC levels with either fibrin degradation product or D-dimer levels were observed. ADAMTS-13:AC levels could be potential diagnostic and prognostic biomarkers for PVT in Japanese patients with LC.

DCC
Also flagged:PeptideBindingpoly-fluoroalkylpeptidesamino acidsankyrin-repeat-domain-containing protein 36B
Journal Article 2024-02-26 ✓ 1 Snippet Burton K, Ghadami S, Dellinger K, Wang B, Dong M.
In-Text Gene Mentions

…g of activatorDCC(5 folds of…

Show Full Abstract

Per- and poly-fluoroalkyl substances (PFAS), such as GenX, are a class of highly stable synthetic compounds that have recently become the focus of environmental remediation endeavors due to their toxicity. While considerable strides have been made in PFAS remediation, the diversity of these compounds, and the costs associated with approaches such as ion exchange resins and advanced oxidation technologies, remain challenging for widespread application. In addition, little is known about the potential binding and impacts of GenX on human proteins. To address these issues, we applied phage display and screened short peptides that bind specifically to GenX, with the ultimate goal of identifying human proteins that bind with GenX. In this study we identified the amino acids that contribute to the binding and measured the binding affinities of the two discovered peptides with NMR. A human protein, ankyrin-repeat-domain-containing protein 36B, with matching sequences of one of the peptides, was identified, and the binding positions were predicted by docking and molecular dynamics simulation. This study created a platform to screen peptides that bind with toxic chemical compounds, which ultimately helped us identify biologically relevant molecules that could be inhibited by the GenX, and also provided information that will contribute to future bioengineered GenX-binding device design.

Also flagged:SynthesisAmidesmethyl estersγ-aminobutyric acidL-prolineL-tyrosine
Journal Article 2024-02-26 No Snippets Theodosis-Nobelos P, Marc G, Rekka EA.
Show Full Abstract

Amides containing methyl esters of γ-aminobutyric acid (GABA), L-proline and L-tyrosine, and esters containing 3-(pyridin-3-yl)propan-1-ol were synthesized by conjugation with 3,5-di-<i>tert</i>-butyl-4-hydroxybenzoic, an NSAID (tolfenamic acid), or 3-phenylacrylic (cinnamic, (<i>E</i>)-3-(3,4-dimethoxyphenyl)acrylic and caffeic) acids. The rationale for the conjugation of such moieties was based on the design of structures with two or more molecular characteristics. The novel compounds were tested for their antioxidant, anti-inflammatory and hypolipidemic properties. Several compounds were potent antioxidants, comparable to the well-known antioxidant, Trolox. In addition, the radical scavenging activity of compound <b>6</b> reached levels that were slightly better than that of Trolox. All the tested compounds demonstrated remarkable activity in the reduction in carrageenan-induced rat paw edema, up to 59% (compound <b>2</b>, a dual antioxidant and anti-inflammatory molecule, with almost 2.5-times higher activity in this experiment than the parent NSAID). Additionally, the compounds caused a significant decrease in the plasma lipidemic indices in Triton-induced hyperlipidemic rats. Compound <b>2</b> decreased total cholesterol by 75.1% and compound <b>3</b> decreased triglycerides by 79.3% at 150 μmol/kg (i.p.). The hypocholesterolemic effect of the compounds was comparable to that of simvastatin, a well-known hypocholesterolemic drug. Additionally, all compounds lowered blood triglycerides. The synthesized compounds with multiple activities, as designed, may be useful as potential candidates for conditions involving inflammation, lipidemic deregulation and oxygen toxicity.

Also flagged:Phytosterol organic acid estersbiomembranesynthesisphytosterolsphytosterol acid estersstigmasteryl vanillate
Journal Article 2024-02-26 No Snippets Zou X, Xu T, Zhao T, Xia J, Zhu F, Hou Y, Lu B, Zhang Y, Yang X.
Show Full Abstract

Phytosterol organic acid esters are important food resources and the components of biomembrane structure. Due to the lack of extraction and synthesis techniques, more research has been focused on phytosterols, and the research on phytosterol acid esters have encountered a bottleneck, but phytosterol acid esters confer substantial benefits to human health. In this study, stigmasteryl vanillate (VAN), stigmasteryl protocatechuate (PRO) and stigmasteryl sinapate (SIN) were prepared through the Steglich reaction. The processes are promotable and the products reach up to 95% purity. In addition, their stability was evaluated by differential scanning calorimetry and thermogravimetric analysis. HPLC analysis revealed an enhancement in water solubility after esterification with phenolic acid. In an <i>in vitro</i> digestion model, the bioaccessibility of stigmasteryl phenolates was significantly higher than that of stigmasterols (STIs). Regarding the anti-inflammatory properties, VAN, PRO, and SIN exhibit superior effects against TNF-α induced pro-inflammatory responses compared to STI. All stigmasteryl phenolates supplementation increased the ATP production, the basal, and maximal oxygen consumption rate in mitochondrial stress test. Overall, we present a synthesis method for stigmasteryl phenolates. It will contribute to the development and research of phytosterol acid ester analysis, functions and utilization in food. Moreover, the nutrient-stigmasterol hybrids tactic we have constructed is practical and can become a targeted mitochondrial delivery strategy with enhanced anti-inflammatory effects.

Also flagged:Keratin 12visionKrt12cell deficiencycytokeratinKrt14
Journal Article 2024-02-26 No Snippets Wolosin JM.
Show Full Abstract

The corneal epithelium (CE) is spread between two domains, the outer vascularized limbus and the avascular cornea proper. Epithelial cells undergo constant migration from the limbus to the vision-critical central cornea. Coordinated with this migration, the cells undergo differentiation changes where a pool of unique stem/precursor cells at the limbus yields the mature cells that reach the corneal center. Differentiation is heralded by the expression of the corneal-specific Krt12. Processing data acquired by scRNA-Seq showed that the increase in Krt12 expression occurs in four distinct steps within the limbus, plus a single continuous increase in the cornea. Differential gene analysis demonstrated that these domains reflect discreet stages of CE differentiation and yielded extensive information of the genes undergoing down- or upregulation in the sequential transition from less to more differentiate conditions. The approach allowed the identification of multiple gene cohorts, including (a) the genes which have maximal expression in the most primitive, Krt12-negative cell cohort, which is likely to include the stem/precursor cells; (b) the sets of genes that undergo continuous increase or decrease along the whole differentiation path; and (c) the genes showing maximal positive or negative correlation with the changes in Krt12.

Also flagged:Post-translational modificationsneurological diseasesinfectionviral infectionstranslational modificationmetabolism
Journal Article 2024-02-26 No Snippets Zhao X, Hu Y, Zhao J, Liu Y, Ma X, Chen H, Xing Y.
Show Full Abstract

Enteroviruses (EVs) are the main cause of a number of neurological diseases. Growing evidence has revealed that successful infection with enteroviruses is highly dependent on the host machinery, therefore, host proteins play a pivotal role in viral infections. Both host and viral proteins can undergo post-translational modification (PTM) which can regulate protein activity, stability, solubility and interactions with other proteins; thereby influencing various biological processes, including cell metabolism, metabolic, signaling pathways, cell death, and cancer development. During viral infection, both host and viral proteins regulate the viral life cycle through various PTMs and different mechanisms, including the regulation of host cell entry, viral protein synthesis, genome replication, and the antiviral immune response. Therefore, protein PTMs play important roles in EV infections. Here, we review the role of various host- and virus-associated PTMs during enterovirus infection.

TRIM38
Also flagged:Osteoporosisbone formationbone resorptionhomeostasisJumonji C domain-containing 1CJMJD1C
Journal Article 2024-02-26 ✓ 1 Snippet Unknown Authors
In-Text Gene Mentions

TRIM38acts as a…

Show Full Abstract

No abstract available.

Preprints.org 2024-02-26 Preprint (No Snippets API) Vincenzetti S, Rozimemet Y, Renzi S, Micozzi D, Fiorini D, Ricciutelli M, Polzonetti V, Pucciarelli S.
Show Full Abstract

The study of the impact of polyQ expansion driven proteotoxicity on cell metabolism has evi-denced NAD molecule as a central player in regulating metabolic response and cell repair in neurodegeneration. The decline in NAD intracellular levels represents a hallmark of ageing aris-ing from a dysregulation between NAD-consuming and biosynthetic enzymatic reactions in which NMNAT plays a key role. By an integrated bioanalytical and proteomic experimental design, the derangement of NAD metabolism deriving from the accumulation of polyQ-Htt protein has been analysed in Saccha-romices cerevisiae harbouring a 103Q-Htt and compared with wild-type Htt, in absence and in presence of a phenolic extract from EVOO, as a source of antioxidant bioactive compounds. Quantification of NAD and its precursors and proteomic analysis of the differential protein ex-pression has been performed by LC-DAD-MS. Chronological lifespan and NAD homeostasis was strongly impaired by proteotoxic polyQ-Htt, eliciting a depletion of NAD levels and accumulation of NaMN. In parallel a downregulation of Sirt2 expression levels has been observed. Phenolic extract administration had no meaningful ef-fects on NAD replenishment to prevent proteotoxicity. NaMN can represent a biomarker of accel-erated aging, and/or a signaling molecule for cell repair.

SOX6
Also flagged:intervertebral disc degenerationNPFOXO1transcription factorAFTGFβ
Journal Article 2024-02-25 ✓ 2 Snippets Swahn H, Mertens J, Olmer M, Myers K, Mondala TS, Natarajan P, Head SR, Alvarez-Garcia O, Lotz MK.
In-Text Gene Mentions

…partners SOX5 andSOX6were part of…

…( SOX5 ,SOX6, and SOX9…

Show Full Abstract

Elucidating how cell populations promote onset and progression of intervertebral disc degeneration (IDD) has the potential to enable more precise therapeutic targeting of cells and mechanisms. Single-cell RNA-sequencing (scRNA-seq) is performed on surgically separated annulus fibrosus (AF) (19,978; 26,983 cells) and nucleus pulposus (NP) (20,884; 24,489 cells) from healthy and diseased human intervertebral discs (IVD). In both tissue types, depletion of cell subsets involved in maintenance of healthy IVD is observed, specifically the immature cell subsets - fibroblast progenitors and stem cells - indicative of an impairment of normal tissue self-renewal. Tissue-specific changes are also identified. In NP, several fibrotic populations are increased in degenerated IVD, indicating tissue-remodeling. In degenerated AF, a novel disease-associated subset is identified, which expresses disease-promoting genes. It is associated with pathogenic biological processes and the main gene regulatory networks include thrombospondin signaling and FOXO1 transcription factor. In NP and AF cells thrombospondin protein promoted expression of genes associated with TGFβ/fibrosis signaling, angiogenesis, and nervous system development. The data reveal new insights of both shared and tissue-specific changes in specific cell populations in AF and NP during IVD degeneration. These identified mechanisms and molecules are novel and more precise targets for IDD prevention and treatment.

Also flagged:opioid receptor mu 1OPRM1COMTresponse to paincatechol‐O ‐methyltransferasecatechol‐O‐methyltransferase
Journal Article 2024-02-25 No Snippets Cheong Y, Lee S, Okazawa H, Kosaka H, Jung M.
Show Full Abstract

<h4>Aim</h4>Pain is reconstructed by brain activities and its subjectivity comes from an interplay of multiple factors. The current study aims to understand the contribution of genetic factors to the neural processing of pain. Focusing on the single-nucleotide polymorphism (SNP) of opioid receptor mu 1 (OPRM1) A<sup>118</sup>G (rs1799971) and catechol-O-methyltransferase (COMT) val<sup>158</sup>met (rs4680), we investigated how the two pain genes affect pain processing.<h4>Method</h4>We integrated a genetic approach with functional neuroimaging. We extracted genomic DNA information from saliva samples to genotype the SNP of OPRM1 and COMT. We used a percept-related model, in which two different levels of perceived pain intensities ("low pain: mildly painful" vs "high pain: severely painful") were employed as experimental stimuli.<h4>Results</h4>Low pain involves a broader network relative to high pain. The distinct effects of pain genes were observed depending on the perceived pain intensity. The effects of low pain were found in supramarginal gyrus, angular gyrus, and anterior cingulate cortex (ACC) for OPRM1 and in middle temporal gyrus for COMT. For high pain, OPRM1 affected the insula and cerebellum, while COMT affected the middle occipital gyrus and ACC.<h4>Conclusion</h4>OPRM1 primarily affects sensory and cognitive components of pain processing, while COMT mainly influences emotional aspects of pain processing. The interaction of the two pain genes was associated with neural patterns coding for high pain and neural activation in the ACC in response to pain. The proteins encoded by the OPRM1 and COMT may contribute to the firing of pain-related neurons in the human ACC, a critical center for subjective pain experience.

BTN3A3
Also flagged:infectionsIntranasal infectionhaemagglutininbindingantibodiesantibody
Journal Article 2024-02-25 ✓ 1 Snippet Gu C, Fan S, Dahn R, Babujee L, Chiba S, Guan L, Maemura T, Pattinson D, Neumann G, Kawaoka Y.
In-Text Gene Mentions

…effect of humanBTN3A3on avian influenza…

Show Full Abstract

<h4>Background</h4>In 2022 and 2023, novel reassortant H3N8 influenza viruses infected three people, marking the first human infections with viruses of this subtype.<h4>Methods</h4>Here, we generated one of these viruses (A/Henan/4-10CNIC/2022; hereafter called A/Henan/2022 virus) by using reverse genetics and characterized it.<h4>Findings</h4>In intranasally infected mice, reverse genetics-generated A/Henan/2022 virus caused weight loss in all five animals (one of which had to be euthanized) and replicated efficiently in the respiratory tract. Intranasal infection of ferrets resulted in minor weight loss and moderate fever but no mortality. Reverse genetics-generated A/Henan/2022 virus replicated efficiently in the upper respiratory tract of ferrets but was not detected in the lungs. Virus transmission via respiratory droplets occurred in one of four pairs of ferrets. Deep-sequencing of nasal swab samples from inoculated and exposed ferrets revealed sequence polymorphisms in the haemagglutinin protein that may affect receptor-binding specificity. We also tested 90 human sera for neutralizing antibodies against reverse genetics-generated A/Henan/2022 virus and found that some of them possessed neutralizing antibody titres, especially sera from older donors with likely exposure to earlier human H3N2 viruses.<h4>Interpretation</h4>Our data demonstrate that reverse genetics-generated A/Henan/2022 virus is a low pathogenic influenza virus (of avian influenza virus descent) with some antigenic resemblance to older human H3N2 viruses and limited respiratory droplet transmissibility in ferrets.<h4>Funding</h4>This work was supported by the Japan Program for Infectious Diseases Research and Infrastructure (JP23wm0125002), and the Japan Initiative for World-leading Vaccine Research and Development Centers (JP233fa627001) from the Japan Agency for Medical Research and Development (AMED).

HFE
Also flagged:Ferroptosisgenetic storage diseases of the liverironhemolytic disordersoxygenalcohol abuse
Journal Article 2024-02-25 ✓ 5 Snippets Teschke R.
In-Text Gene Mentions

Hemochromatosis is an autosomal-recessive disorder caused by mutations in the genes involved in iron metabolism responsible for the abnormal increase in intestinal iron absorption [31] as a consequence of mutations in several genes, including HFE, transferrin receptor 2 (TFR2), hepcidin, ferroportin (SLC40A1), and hemojuvelin (HFE2) [31,33,34,92,96].

In patients with hemochromatosis, the molecular finetuning of physiological intestinal iron uptake is set off primarily due to genetic mutations in the HFE gene that cause an increased absorption of iron despite a normal dietary iron intake.

Hemochromatosis occurs in homozygotes with a mutation of the HFE gene at a prevalence of 1:300 to 1:500 individuals [34].

In patients with hemochromatosis, the molecular finetuning of intestinal iron uptake is set off due to mutations in the high-FE2+ (HFE) genes that lead to a lack of hepcidin or resistance on the part of ferroportin to hepcidin binding.

The observation that several hemochromatosis patients had elevated levels of IL8 is difficult to explain but may be due to the fact that the C282Y HFE protein induces the transcription factor NF-κB, which consequently results in a marked increase in protein production of IL8 along with an increased transcriptional activation of IL8 in C282Y HFE-expressing cells [31,124].

Show Full Abstract

Hemochromatosis represents clinically one of the most important genetic storage diseases of the liver caused by iron overload, which is to be differentiated from hepatic iron overload due to excessive iron release from erythrocytes in patients with genetic hemolytic disorders. This disorder is under recent mechanistic discussion regarding ferroptosis, reactive oxygen species (ROS), the gut microbiome, and alcohol abuse as a risk factor, which are all topics of this review article. Triggered by released intracellular free iron from ferritin via the autophagic process of ferritinophagy, ferroptosis is involved in hemochromatosis as a specific form of iron-dependent regulated cell death. This develops in the course of mitochondrial injury associated with additional iron accumulation, followed by excessive production of ROS and lipid peroxidation. A low fecal iron content during therapeutic iron depletion reduces colonic inflammation and oxidative stress. In clinical terms, iron is an essential trace element required for human health. Humans cannot synthesize iron and must take it up from iron-containing foods and beverages. Under physiological conditions, healthy individuals allow for iron homeostasis by restricting the extent of intestinal iron depending on realistic demand, avoiding uptake of iron in excess. For this condition, the human body has no chance to adequately compensate through removal. In patients with hemochromatosis, the molecular finetuning of intestinal iron uptake is set off due to mutations in the high-FE<sup>2+</sup> (<i>HFE</i>) genes that lead to a lack of hepcidin or resistance on the part of ferroportin to hepcidin binding. This is the major mechanism for the increased iron stores in the body. Hepcidin is a liver-derived peptide, which impairs the release of iron from enterocytes and macrophages by interacting with ferroportin. As a result, iron accumulates in various organs including the liver, which is severely injured and causes the clinically important hemochromatosis. This diagnosis is difficult to establish due to uncharacteristic features. Among these are asthenia, joint pain, arthritis, chondrocalcinosis, diabetes mellitus, hypopituitarism, hypogonadotropic hypogonadism, and cardiopathy. Diagnosis is initially suspected by increased serum levels of ferritin, a non-specific parameter also elevated in inflammatory diseases that must be excluded to be on the safer diagnostic side. Diagnosis is facilitated if ferritin is combined with elevated fasting transferrin saturation, genetic testing, and family screening. Various diagnostic attempts were published as algorithms. However, none of these were based on evidence or quantitative results derived from scored key features as opposed to other known complex diseases. Among these are autoimmune hepatitis (AIH) or drug-induced liver injury (DILI). For both diseases, the scored diagnostic algorithms are used in line with artificial intelligence (AI) principles to ascertain the diagnosis. The first-line therapy of hemochromatosis involves regular and life-long phlebotomy to remove iron from the blood, which improves the prognosis and may prevent the development of end-stage liver disease such as cirrhosis and hepatocellular carcinoma. Liver transplantation is rarely performed, confined to acute liver failure. In conclusion, ferroptosis, ROS, the gut microbiome, and concomitant alcohol abuse play a major contributing role in the development and clinical course of genetic hemochromatosis, which requires early diagnosis and therapy initiation through phlebotomy as a first-line treatment.

CA10
Also flagged:Coronary heart diseasedeathmyocardial infarctionMIheart failurewound healing
Journal Article 2024-02-25 ✓ 1 Snippet Su Y, Shi D, Xia G, Liu Y, Xu L, Dao L, Lu X, Shen C, Xu C.
In-Text Gene Mentions

…CA3, CA7, CA8,CA10, CA11, CA13), three…

Show Full Abstract

Appropriate fibrosis is required to prevent subsequent adverse remodeling and heart failure post myocardial infarction (MI), and cardiac fibroblasts (CFs) play a critical role during the process. Carbonic anhydrase 3 (CAR3) is an important mediator in multiple biological processes besides its CO<sub>2</sub> hydration activity; however, the role and underlying mechanism of CAR3 on cardiac repair post MI injury remains unknown. Here, we found that CAR3 expression was up-regulated in cardiac tissue in infarct area at the reparative phase of MI, with a peak at 7 days post MI. The upregulation was detected mainly on fibroblast instead of cardiomyocyte, and primary cardiac fibroblasts treated with TGF-β1 recaptured our observation. While CAR3 deficiency leads to weakened collagen density, enlarged infarct size and aggravated cardiac dysfunction post-MI. In fibroblast, we observed that CAR3 deficiency restrains collagen synthesis, cell migration and gel contraction of cardiac fibroblasts, whereas overexpression of CAR3 in CFs improves wound healing and cardiac fibroblast activation. Mechanistically, CAR3 stabilizes Smad7 protein via modulating its acetylation, which dampens phosphorylation of Smad2 and Smad3, thus inhibiting fibroblast transformation. In contrast, inhibition of Smad7 acetylation with C646 blunts CAR3 deficiency induced suppression of fibroblast activation and impaired cardiac healing. Our data demonstrate a protective role of CAR3 in cardiac wound repair post MI via promoting fibroblasts activation through Smad7-TGF-β/Smad2/3 signaling pathway.

ZNFX1
Also flagged:DOT1LCD44Wnttelomere silencing 1-likegene expressiongastric cancer
Journal Article 2024-02-25 ✓ 1 Snippet Li P, Zhang Z, Sun P.
In-Text Gene Mentions

…TTN, FLG, MUC4,ZNFX1, PIKFYVE, MUC16, PPP2R5D,…

Show Full Abstract

To assess telomere silencing 1-like (DOTIL) gene expression within gastric cancer (GC) tissues as well as its function of promoting cancer stem cell (CSC)-mediated epithelial-mesenchymal switching, tissue samples from 8 patients each in 3 stages (normal, low-grade intraepithelial neoplasia (LGIN), as well as early gastric carcinoma (EGC)) were collected for whole-exome sequencing, which revealed differentially expressed genes (DEGs). The DEGs and their prognostic value were verified through TCGA and GTEx analyses. We also verified the role of DOT1L in EGC development. We collected samples from three patients each with LGIN and EGC for single-cell sequencing. We conducted single-cell transcriptomic analysis, DEG analysis, cell‒cell interaction analysis, and pseudotime analysis using R language. Sites and levels of DOT1L, CD44 and DOT1L expression were verified by IF. We found 703 deleterious mutation sites in the LGIN group and 389 deleterious mutation sites in the EGC group. The LGIN as well as EGC categories exhibited increased levels of DOT1L expression compared to the standard category (P<0.05) in TCGA and GTEx. DOT1L also correlated significantly with TMB (P=8.45E-06), MSI (P=0.001), and tumor proliferation index (P=7.17E-09) in the TCGA and GTEx datasets. In single cells, we found that DOT1L promotes CD44 expression via the Wnt/β-catenin signaling pathway and the development for stemness properties within GC. In addition, we found that DOT1L, CD44 and CTNNB1 colocalize and correlate positively. In conclusion, one important CSC regulator in GC, DOT1L may be crucial in coordinating the expression of genes specific to a certain lineage during MSC development.

B4GALT5
Also flagged:glycosyltransferasetumorovarian cancerOCGlycosyltransferasesGT
Journal Article 2024-02-25 ✓ 1 Snippet Zhang Y, Zhou T, Tang Q, Feng B, Liang Y.
In-Text Gene Mentions

B4GALT5

Show Full Abstract

<h4>Background</h4>Glycosyltransferases (GT) play a crucial role in glycosylation reactions, and aberrant expression of glycosyltransferase-related genes (GTs) leads to abnormal glycosylation, which is associated with tumor progression. However, the prognostic value of aberrant expression of GTs in ovarian cancer (OC) and the correlation between GTs and tumor microenvironment (TME) remain unknown.<h4>Methods</h4>TCGA and GSE53963 databases were used to obtain data on OC patient samples. The association of GTs with OC was analyzed. Molecular subtypes were identified by consensus unsupervised clustering, followed by immune infiltration and functional enrichment analyses. Survival analysis was performed using Kaplan-Meier curves and log-rank tests. Least Absolute Shrinkage and Selection Operator (LASSO) and multifactorial cox regression were used to screen for signature genes associated with OC and used to establish prognostic models.<h4>Result</h4>OC patients were categorized into 5 GTs clusters using consensus unsupervised cluster analysis. Clusters D and E showed significant differences between survival, signaling pathways and immune infiltration. Then, a risk model was developed based on the 12 signature genes, which provides a more accurate evaluation of the prognosis of OC patients. We categorized patients into high-risk and low-risk groups based on the risk score and found that the survival of patients in the high-risk group was significantly lower than that in the low-risk group. Moreover, the risk score was significantly correlated with tumor microenvironment, immune infiltration, and chemotherapy sensitivity.<h4>Conclusion</h4>Overall, we performed a comprehensive analysis of GTs in OC patients and developed a risk model for OC. Our findings will provide a new insight to OC prognosis and treatment.

SERPINC1
Also flagged:ADcollagenasedigestiontrypsinoil redAlizarin Red S
Journal Article 2024-02-25 ✓ 1 Snippet Tareen WA, Saba E, Rashid U, Sarfraz A, Yousaf MS, Habib-Ur-Rehman, Rehman HF, Sandhu MA.
In-Text Gene Mentions

TRT-III

Show Full Abstract

<h4>Objective</h4>In regenerative biology, the most commonly used cells are adipose tissue-derived mesenchymal stem cells (AD-MSCs). This is due to the abundance and easy accessibility of AD-MSCs.<h4>Methods</h4>In this study, canine AD-MSCs were harvested from different anatomical locations, i.e., subcutaneous (SC), omental (OM), and perirenal (PR). Various isolation techniques namely explants (TRT-I), collagenase-digestion (TRT-II), collagenase-digested explants (TRT-III), and trypsin-digested explants (TRT-IV) were used to segregate the MSCs to evaluate cell doubling time, viability, and adipogenic/osteogenic lineage differentiation potential.<h4>Results</h4>The study showed that the SC stem cells had superior growth kinetics compared to other tissues, while the cells isolated through TRT-II performed better than the other cell isolation procedures. The metabolic status of cells isolated from dog adipose tissue indicated that all cells had adequate metabolic rates. However, SC-MSCs derived from TRT-III and TRT-IV outperformed those derived from TRT-I and TRT-II. The differentiation analysis revealed that cells differentiate into adipogenic and osteogenic lineage regardless of treatment, as demonstrated by positive oil red O (ORO) and Alizarin Red S (ALZ) stain. It is worth mentioning that cells derived from TRT-III had larger and more intracellular droplets compared to the other treatments. The TRT-I, -II, and -III showed greater osteogenic differentiation in cells isolated from PR and OM regions compared to SC-derived cells. However, the TRT-IV resulted in better osteogenic differentiation in cells from SC, followed by the OM and PR-derived cells.<h4>Conclusion</h4>It is concluded that all methods of MSCs isolation from adipose tissues are successful; however, the TRT-II had the highest rate of cell re-assortment from the SC, while, TRT-II and -IV are most suitable for isolating cells from PR and OM adipose tissue.

ZNFX1
Also flagged:Infectionsmycobacterial diseaseMSMDinfectionInborn errors of immunityimmune response
Journal Article 2024-02-25 ✓ 2 Snippets Dalvi A, Bargir UA, Natraj G, Shah I, Madkaikar M.
In-Text Gene Mentions

Mutations in 21 different genes (IFNGR1, IFNGR2, IFNG, IL12RB1, IL12RB2, IL23R, IL12B, ISG15, USP18, ZNFX1, TBX21, STAT1, TYK2, IRF8, CYBB, JAK1, RORC, NEMO, SPPL2A, MCTS1, and IRF1) with more than 35 different genetic etiologies of MSMD have been described [12,13,14,15,16,17,18].

…, USP18 ,ZNFX1, TBX21 ,…

Show Full Abstract

The diagnosis and treatment of patients with mendelian susceptibility to mycobacterial disease (MSMD) pose consistent challenges due to the diverse infection spectrum observed in this population. Common clinical manifestations include Bacillus Calmette-Guérin vaccine (BCG) complications in countries where routine BCG vaccination is practiced, while in non-BCG-vaccinating countries, Non-Tuberculous Mycobacteria (NTM) is prevalent. In tuberculosis-endemic regions, Mycobacterium tuberculosis (MTB) has a high prevalence, along with other intracellular organisms. Isolating these organisms presents a significant challenge, and treatment is often initiated without confirming the specific species. This review primarily focuses on the methods and challenges associated with diagnosing and treating MSMD patients.

Also flagged:mineralinfectious diseaseswatermatingPst IMsp I
Journal Article 2024-02-25 No Snippets Volkova NA, Romanov MN, Abdelmanova AS, Larionova PV, German NY, Vetokh AN, Shakhin AV, Volkova LA, Sermyagin AA, Anshakov DV, Fisinin VI, Griffin DK, Sölkner J, Brem G, McEwan JC, Brauning R, Zinovieva NA.
Show Full Abstract

The search for SNPs and candidate genes that determine the manifestation of major selected traits is one crucial objective for genomic selection aimed at increasing poultry production efficiency. Here, we report a genome-wide association study (GWAS) for traits characterizing meat performance in the domestic quail. A total of 146 males from an F<sub>2</sub> reference population resulting from crossing a fast (Japanese) and a slow (Texas White) growing breed were examined. Using the genotyping-by-sequencing technique, genomic data were obtained for 115,743 SNPs (92,618 SNPs after quality control) that were employed in this GWAS. The results identified significant SNPs associated with the following traits at 8 weeks of age: body weight (nine SNPs), daily body weight gain (eight SNPs), dressed weight (33 SNPs), and weights of breast (18 SNPs), thigh (eight SNPs), and drumstick (three SNPs). Also, 12 SNPs and five candidate genes (<i>GNAL</i>, <i>DNAJC6</i>, <i>LEPR</i>, <i>SPAG9</i>, and <i>SLC27A4</i>) shared associations with three or more traits. These findings are consistent with the understanding of the genetic complexity of body weight-related traits in quail. The identified SNPs and genes can be used in effective quail breeding as molecular genetic markers for growth and meat characteristics for the purpose of genetic improvement.

HTT
Also flagged:Stem cell differentiationHDneuro-degenerative disorderHuntingtinproteopathic disordersALS
Journal Article 2024-02-24 ✓ 1 Snippet Witmer A, Bhanu B.
In-Text Gene Mentions

…that affects theHTTgene in the…

Show Full Abstract

Many critical issues arise when training deep neural networks using limited biological datasets. These include overfitting, exploding/vanishing gradients and other inefficiencies which are exacerbated by class imbalances and can affect the overall accuracy of a model. There is a need to develop semi-supervised models that can reduce the need for large, balanced, manually annotated datasets so that researchers can easily employ neural networks for experimental analysis. In this work, Iterative Pseudo Balancing (IPB) is introduced to classify stem cell microscopy images while performing on the fly dataset balancing using a student-teacher meta-pseudo-label framework. In addition, multi-scale patches of multi-label images are incorporated into the network training to provide previously inaccessible image features with both local and global information for effective and efficient learning. The combination of these inputs is shown to increase the classification accuracy of the proposed deep neural network by 3[Formula: see text] over baseline, which is determined to be statistically significant. This work represents a novel use of pseudo-labeling for data limited settings, which are common in biological image datasets, and highlights the importance of the exhaustive use of available image features for improving performance of semi-supervised networks. The proposed methods can be used to reduce the need for expensive manual dataset annotation and in turn accelerate the pace of scientific research involving non-invasive cellular imaging.

TNFSF4
Also flagged:PD-1antibodybindingPD-L1tumorsnasopharyngeal carcinoma
Journal Article 2024-02-24 ✓ 1 Snippet Rajasekaran N, Wang X, Ravindranathan S, Chin DJ, Tseng SY, Klakamp SL, Widmann K, Kapoor VN, Vexler V, Keegan P, Yao S, LaVallee T, Khare SD.
In-Text Gene Mentions

…These include: IL12RB2,TNFSF4, ARID5A, SCRIB, PTPN22,…

Show Full Abstract

Over the past decade, US Food and Drug Administration (FDA)-approved immune checkpoint inhibitors that target programmed death-1 (PD-1) have demonstrated significant clinical benefit particularly in patients with PD-L1 expressing tumors. Toripalimab is a humanized anti-PD-1 antibody, approved by FDA for first-line treatment of nasopharyngeal carcinoma in combination with chemotherapy. In a post hoc analysis of phase 3 studies, toripalimab in combination with chemotherapy improved overall survival irrespective of PD-L1 status in nasopharyngeal carcinoma (JUPITER-02), advanced non-small cell lung cancer (CHOICE-01) and advanced esophageal squamous cell carcinoma (JUPITER-06). On further characterization, we determined that toripalimab is molecularly and functionally differentiated from pembrolizumab, an anti-PD-1 mAb approved previously for treating a wide spectrum of tumors. Toripalimab, which binds the FG loop of PD-1, has 12-fold higher binding affinity to PD-1 than pembrolizumab and promotes significantly more Th1- and myeloid-derived inflammatory cytokine responses in healthy human PBMCs in vitro. In an ex vivo system employing dissociated tumor cells from treatment naïve non-small cell lung cancer patients, toripalimab induced several unique genes in IFN-γ and immune cell pathways, showed different kinetics of activation and significantly enhanced IFN-γ signature. Additionally, binding of toripalimab to PD-1 induced lower levels of SHP1 and SHP2 recruitment, the negative regulators of T cell activation, in Jurkat T cells ectopically expressing PD-1. Taken together, these data demonstrate that toripalimab is a potent anti-PD-1 antibody with high affinity PD-1 binding, strong functional attributes and demonstrated clinical activity that encourage its continued clinical investigation in several types of cancer.

Also flagged:critical illnesscriticalPICSIntensive Care Syndromeacute respiratory distress syndromeacute lung disease
Journal Article 2024-02-24 No Snippets Curley MAQ, Watson RS, Killien EY, Kalvas LB, Perry-Eaddy MA, Cassidy AM, Miller EB, Talukder M, Manning JC, Pinto NP, Rennick JE, Colville G, Asaro LA, Wypij D.
Show Full Abstract

<h4>Introduction</h4>As paediatric intensive care unit (PICU) mortality declines, there is growing recognition of the morbidity experienced by children surviving critical illness and their families. A comprehensive understanding of the adverse physical, cognitive, emotional and social sequelae common to PICU survivors is limited, however, and the trajectory of recovery and risk factors for morbidity remain unknown.<h4>Methods and analysis</h4>The Post-Intensive Care Syndrome <b>-</b> paediatrics Longitudinal Cohort Study will evaluate child and family outcomes over 2 years following PICU discharge and identify child and clinical factors associated with impaired outcomes. We will enrol 750 children from 30 US PICUs during their first PICU hospitalisation, including 500 case participants experiencing ≥3 days of intensive care that include critical care therapies (eg, mechanical ventilation, vasoactive infusions) and 250 age-matched, sex-matched and medical complexity-matched control participants experiencing a single night in the PICU with no intensive care therapies. Children, parents and siblings will complete surveys about health-related quality of life, physical function, cognitive status, emotional health and peer and family relationships at multiple time points from baseline recall through 2 years post-PICU discharge. We will compare outcomes and recovery trajectories of case participants to control participants, identify risk factors associated with poor outcomes and determine the emotional and social health consequences of paediatric critical illness on parents and siblings.<h4>Ethics and dissemination</h4>This study has received ethical approval from the University of Pennsylvania Institutional Review Board (protocol #843844). Our overall objective is to characterise the ongoing impact of paediatric critical illness to guide development of interventions that optimise outcomes among children surviving critical illness and their families. Findings will be presented at key disciplinary meetings and in peer-reviewed publications at fixed data points. Published manuscripts will be added to our public study website to ensure findings are available to families, clinicians and researchers.<h4>Trials registration number</h4>NCT04967365.

Also flagged:apolipoprotein BApolipoprotein B-100APOBcholesterollipoproteinchronic disease
Journal Article 2024-02-24 No Snippets Martin L, Boutwell BB, Messerlian C, Adams CD.
Show Full Abstract

Apolipoprotein B-100 (APOB) is a component of fat- and cholesterol-transporting molecules in the bloodstream. It is the main lipoprotein in low-density lipoprotein cholesterol (LDL) and has been implicated in conditions that end healthspan (the interval between birth and onset of chronic disease). However, APOB's direct relationship with healthspan remains uncertain. With Mendelian randomization, we show that higher levels of APOB and LDL shorten healthspan in humans. Multivariable Mendelian randomization of APOB and LDL on healthspan suggests that the predominant trait accounting for the relationship is APOB. In addition, we provide preliminary evidence that APOB increases risk for Alzheimer's disease, a condition that ends healthspan. If these relationships are causal, they suggest that interventions to improve healthspan in aging populations could include strategies targeting APOB. Ultimately, given that more than 44 million people currently suffer from Alzheimer's disease worldwide, such interventions are needed.

PEBP1
Also flagged:coronary heart diseaseFerroptosisirondeathlipidperoxides
Journal Article 2024-02-24 ✓ 1 Snippet Wu X, Li J, Chai S, Li C, Lu S, Bao S, Yu S, Guo H, He J, Peng Y, Sun H, Wang L.
In-Text Gene Mentions

…BID, DUSP1, EPAS1,PEBP1, ULK1, FANCD2, FBXW7,…

Show Full Abstract

<h4>Background</h4>Acute myocardial infarction (AMI) is indeed a significant cause of mortality and morbidity in individuals with coronary heart disease. Ferroptosis, an iron-dependent cell death, is characterized by the accumulation of intracellular lipid peroxides, which is implicated in cardiomyocyte injury. This study aims to identify biomarkers that are indicative of ferroptosis in the context of AMI, and to examine their potential roles in immune infiltration.<h4>Methods</h4>Firstly, the GSE59867 dataset was used to identify differentially expressed ferroptosis-related genes (DE-FRGs) in AMI. We then performed gene ontology (GO) and functional enrichment analysis on these DE-FRGs. Secondly, we analyzed the GSE76591 dataset and used bioinformatic methods to build ceRNA networks. Thirdly, we identified hub genes in protein-protein interaction (PPI) network. After obtaining the key DE-FRGs through the junction of hub genes with ceRNA and least absolute shrinkage and selection operator (LASSO). ImmucellAI was applied to estimate the immune cell infiltration in each sample and examine the relationship between key DE-FRGs and 24 immunocyte subsets. The diagnostic performance of these genes was further evaluated using the receiver operating characteristic (ROC) curve analysis. Ultimately, we identified an immune-related ceRNA regulatory axis linked to ferroptosis in AMI.<h4>Results</h4>Among 56 DE-FRGs identified in AMI, 41 of them were integrated into the construction of competitive endogenous RNA (ceRNA) networks. TLR4 and PIK3CA were identified as key DE-FRGs and PIK3CA was confirmed as a diagnostic biomarker for AMI. Moreover, CD4_native cells, nTreg cells, Th2 cells, Th17 cells, central-memory cells, effector-memory cells, and CD8_T cells had higher infiltrates in AMI samples compared to control samples. In contrast, exhausted cells, iTreg cells, and Tfh cells had lower infiltrates in AMI samples. Spearman analysis confirmed the correlation between 24 immune cells and PIK3CA/TLR4. Ultimately, we constructed an immune-related regulatory axis involving XIST and OIP5-AS1/miR-216a/PIK3CA.<h4>Conclusion</h4>Our comprehensive analysis has identified PIK3CA as a robust and promising biomarker for this condition. Moreover, we have also identified an immune-related regulatory axis involving XIST and OIP5-AS1/miR-216a/PIK3CA, which may play a key role in regulating ferroptosis during AMI progression.

ABT1
Also flagged:IGHMBP2immunoglobulin muSMA with respiratory distress type ISMARD1Charcot Marie Tooth type 2SCMT2S
Journal Article 2024-02-24 ✓ 2 Snippets Vadla GP, Singh K, Lorson CL, Lorson MA.
In-Text Gene Mentions

…of basal transcription (ABT1) impact the ATPase…

ABT1

Show Full Abstract

Mutations within immunoglobulin mu DNA binding protein (IGHMBP2), an RNA-DNA helicase, result in SMA with respiratory distress type I (SMARD1) and Charcot Marie Tooth type 2S (CMT2S). The underlying biochemical mechanism of IGHMBP2 is unknown as well as the functional significance of IGHMBP2 mutations in disease severity. Here we report the biochemical mechanisms of IGHMBP2 disease-causing mutations D565N and H924Y, and their potential impact on therapeutic strategies. The IGHMBP2-D565N mutation has been identified in SMARD1 patients, while the IGHMBP2-H924Y mutation has been identified in CMT2S patients. For the first time, we demonstrate a correlation between the altered IGHMBP2 biochemical activity associated with the D565N and H924Y mutations and disease severity and pathology in patients and our Ighmbp2 mouse models. We show that IGHMBP2 mutations that alter the association with activator of basal transcription (ABT1) impact the ATPase and helicase activities of IGHMBP2 and the association with the 47S pre-rRNA 5' external transcribed spacer. We demonstrate that the D565N mutation impairs IGHMBP2 ATPase and helicase activities consistent with disease pathology. The H924Y mutation alters IGHMBP2 activity to a lesser extent while maintaining association with ABT1. In the context of the compound heterozygous patient, we demonstrate that the total biochemical activity associated with IGHMBP2-D565N and IGHMBP2-H924Y proteins is improved over IGHMBP2-D565N alone. Importantly, we demonstrate that the efficacy of therapeutic applications may vary based on the underlying IGHMBP2 mutations and the relative biochemical activity of the mutant IGHMBP2 protein.

CSE1LZNFX1
Also flagged:Colorectal CancerColon CancerMUTYHtransforming growth factor(TGF) βsuppressor of Mothers Against Decapentaplegic
Journal Article 2024-02-24 ✓ 2 Snippets Laskar RS, Qu C, Huyghe JR, Harrison T, Hayes RB, Cao Y, Campbell PT, Steinfelder R, Talukdar FR, Brenner H, Ogino S, Brendt S, Bishop DT, Buchanan DD, Chan AT, Cotterchio M, Gruber SB, Gsur A, van Guelpen B, Jenkins MA, Keku TO, Lynch BM, Le Marchand L, Martin RM, McCarthy K, Moreno V, Pearlman R, Song M, Tsilidis KK, Vodička P, Woods MO, Wu K, Hsu L, Gunter MJ, Peters U, Murphy N, Colorectal Transdisciplinary (CORECT) Study, the Colon Cancer Family Registry (CCFR), Genetics and Epidemiology of Colorectal Cancer Consortium (GECCO).
In-Text Gene Mentions

…, ARHGAP11A ,ZNFX1, SNORD12B ,…

…, SNORD12B ,CSE1L, and OSBPL2 (…

Show Full Abstract

<h4>Background</h4>The incidence of early-onset colorectal cancer (EOCRC; diagnosed <50 years of age) is rising globally; however, the causes underlying this trend are largely unknown. CRC has strong genetic and environmental determinants, yet common genetic variants and causal modifiable risk factors underlying EOCRC are unknown. We conducted the first EOCRC-specific genome-wide association study (GWAS) and Mendelian randomization (MR) analyses to explore germline genetic and causal modifiable risk factors associated with EOCRC.<h4>Patients and methods</h4>We conducted a GWAS meta-analysis of 6176 EOCRC cases and 65 829 controls from the Genetics and Epidemiology of Colorectal Cancer Consortium (GECCO), the Colorectal Transdisciplinary Study (CORECT), the Colon Cancer Family Registry (CCFR), and the UK Biobank. We then used the EOCRC GWAS to investigate 28 modifiable risk factors using two-sample MR.<h4>Results</h4>We found two novel risk loci for EOCRC at 1p34.1 and 4p15.33, which were not previously associated with CRC risk. We identified a deleterious coding variant (rs36053993, G396D) at polyposis-associated DNA repair gene MUTYH (odds ratio 1.80, 95% confidence interval 1.47-2.22) but show that most of the common genetic susceptibility was from noncoding signals enriched in epigenetic markers present in gastrointestinal tract cells. We identified new EOCRC-susceptibility genes, and in addition to pathways such as transforming growth factor (TGF) β, suppressor of Mothers Against Decapentaplegic (SMAD), bone morphogenetic protein (BMP) and phosphatidylinositol kinase (PI3K) signaling, our study highlights a role for insulin signaling and immune/infection-related pathways in EOCRC. In our MR analyses, we found novel evidence of probable causal associations for higher levels of body size and metabolic factors-such as body fat percentage, waist circumference, waist-to-hip ratio, basal metabolic rate, and fasting insulin-higher alcohol drinking, and lower education attainment with increased EOCRC risk.<h4>Conclusions</h4>Our novel findings indicate inherited susceptibility to EOCRC and suggest modifiable lifestyle and metabolic targets that could also be used to risk-stratify individuals for personalized screening strategies or other interventions.

Also flagged:tauopathyTauopathiesneurodegenerative disorderstaugene expressionsarcomeric
Journal Article 2024-02-24 No Snippets Alava B, Hery G, Sidhom S, Gutierrez-Monreal M, Prokop S, Esser KA, Abisambra J.
Show Full Abstract

Tauopathies are neurodegenerative disorders in which the pathological intracellular aggregation of the protein tau causes cognitive deficits. Additionally, clinical studies report muscle weakness in populations with tauopathy. However, whether neuronal pathological tau species confer muscle weakness, and whether skeletal muscle maintains contractile capacity in primary tauopathy remains unknown. Here, we identified skeletal muscle abnormalities in a mouse model of primary tauopathy, expressing human mutant P301L-tau using adeno-associated virus serotype 8 (AAV8). AAV8-P301L mice showed grip strength deficits, hyperactivity, and abnormal histological features of skeletal muscle. Additionally, spatially resolved gene expression of muscle cross sections were altered in AAV8-P301L myofibers. Transcriptional changes showed alterations of genes encoding sarcomeric proteins, proposing a weakness phenotype. Strikingly, specific force of the soleus muscle was blunted in AAV8-P301L tau male mice. Our findings suggest tauopathy has peripheral consequences in skeletal muscle that contribute to weakness in tauopathy.

Also flagged:Menarchefetal growth restrictionFGRovulationvitamin Dmetabolism
Journal Article 2024-02-24 No Snippets Reshetnikov E, Churnosova M, Reshetnikova Y, Stepanov V, Bocharova A, Serebrova V, Trifonova E, Ponomarenko I, Sorokina I, Efremova O, Orlova V, Batlutskaya I, Ponomarenko M, Churnosov V, Aristova I, Polonikov A, Churnosov M.
Show Full Abstract

We aimed to explore the potential link of maternal age at menarche (mAAM) gene polymorphisms with risk of the fetal growth restriction (FGR). This case (FGR)-control (FGR free) study included 904 women (273 FGR and 631 control) in the third trimester of gestation examined/treated in the Departments of Obstetrics. For single nucleotide polymorphism (SNP) multiplex genotyping, 50 candidate loci of mAAM were chosen. The relationship of mAAM SNPs and FGR was appreciated by regression procedures (logistic/model-based multifactor dimensionality reduction [MB-MDR]) with subsequent in silico assessment of the assumed functionality pithy of FGR-related loci. Three mAAM-appertain loci were FGR-linked to genes such as <i>KISS1</i> (rs7538038) (effect allele G-odds ratio (OR)<sub>allelic</sub> = 0.63/p<sub>perm</sub> = 0.0003; OR<sub>additive</sub> = 0.61/p<sub>perm</sub> = 0.001; OR<sub>dominant</sub> = 0.56/p<sub>perm</sub> = 0.001), <i>NKX2-1</i> (rs999460) (effect allele A-OR<sub>allelic</sub> = 1.37/p<sub>perm</sub> = 0.003; OR<sub>additive</sub> = 1.45/p<sub>perm</sub> = 0.002; OR<sub>recessive</sub> = 2.41/p<sub>perm</sub> = 0.0002), <i>GPRC5B</i> (rs12444979) (effect allele T-OR<sub>allelic</sub> = 1.67/p<sub>perm</sub> = 0.0003; OR<sub>dominant</sub> = 1.59/p<sub>perm</sub> = 0.011; OR<sub>additive</sub> = 1.56/p<sub>perm</sub> = 0.009). The haplotype ACA <i>FSHB</i> gene (rs555621*rs11031010*rs1782507) was FRG-correlated (OR = 0.71/p<sub>perm</sub> = 0.05). Ten FGR-implicated interworking models were founded for 13 SNPs (p<sub>perm</sub> ≤ 0.001). The rs999460 <i>NKX2-1</i> and rs12444979 <i>GPRC5B</i> interplays significantly influenced the FGR risk (these SNPs were present in 50% of models). FGR-related mAAM-appertain 15 polymorphic variants and 350 linked SNPs were functionally momentous in relation to 39 genes participating in the regulation of hormone levels, the ovulation cycle process, male gonad development and vitamin D metabolism. Thus, this study showed, for the first time, that the mAAM-appertain genes determine FGR risk.

PRDX6
Also flagged:thiol transferasesthiolsGlutathionebacillithiolmycothiolergothioneine
Journal Article 2024-02-24 ✓ 1 Snippet Tossounian MA, Zhao Y, Yu BYK, Markey SA, Malanchuk O, Zhu Y, Cain A, Gout I.
In-Text Gene Mentions

A study showed that GST Pi (GSTP1) can regulate peroxiredoxin 6 (PRDX6) through the conjugation of glutathione onto the protein [84].

Show Full Abstract

Low-molecular-weight (LMW) thiols are produced in all living cells in different forms and concentrations. Glutathione (GSH), coenzyme A (CoA), bacillithiol (BSH), mycothiol (MSH), ergothioneine (ET) and trypanothione T(SH)<sub>2</sub> are the main LMW thiols in eukaryotes and prokaryotes. LMW thiols serve as electron donors for thiol-dependent enzymes in redox-mediated metabolic and signaling processes, protect cellular macromolecules from oxidative and xenobiotic stress, and participate in the reduction of oxidative modifications. The level and function of LMW thiols, their oxidized disulfides and mixed disulfide conjugates in cells and tissues is tightly controlled by dedicated oxidoreductases, such as peroxiredoxins, glutaredoxins, disulfide reductases and LMW thiol transferases. This review provides the first summary of the current knowledge of structural and functional diversity of transferases for LMW thiols, including GSH, BSH, MSH and T(SH)<sub>2</sub>. Their role in maintaining redox homeostasis in single-cell and multicellular organisms is discussed, focusing in particular on the conjugation of specific thiols to exogenous and endogenous electrophiles, or oxidized protein substrates. Advances in the development of new research tools, analytical methodologies, and genetic models for the analysis of known LMW thiol transferases will expand our knowledge and understanding of their function in cell growth and survival under oxidative stress, nutrient deprivation, and during the detoxification of xenobiotics and harmful metabolites. The antioxidant function of CoA has been recently discovered and the breakthrough in defining the identity and functional characteristics of CoA S-transferase(s) is soon expected.

DCC
Also flagged:cognitionmajor depressive disorderpsychiatric disorderdepressioncognitive function impairmentcognitive impairments
Journal Article 2024-02-24 ✓ 1 Snippet Zheng W, Zhang Q, Zhao Z, Zhang P, Zhao L, Wang X, Yang S, Zhang J, Yao Z, Hu B.
In-Text Gene Mentions

DCC

Show Full Abstract

Thalamocortical circuitry has a substantial impact on emotion and cognition. Previous studies have demonstrated alterations in thalamocortical functional connectivity (FC), characterized by region-dependent hypo- or hyper-connectivity, among individuals with major depressive disorder (MDD). However, the dynamical reconfiguration of the thalamocortical system over time and potential abnormalities in dynamic thalamocortical connectivity associated with MDD remain unclear. Hence, we analyzed dynamic FC (dFC) between ten thalamic subregions and seven cortical subnetworks from resting-state functional magnetic resonance images of 48 patients with MDD and 57 healthy controls (HCs) to investigate time-varying changes in thalamocortical FC in patients with MDD. Moreover, dynamic laterality analysis was conducted to examine the changes in functional lateralization of the thalamocortical system over time. Correlations between the dynamic measures of thalamocortical FC and clinical assessment were also calculated. We identified four dynamic states of thalamocortical circuitry wherein patients with MDD exhibited decreased fractional time and reduced transitions within a negative connectivity state that showed strong correlations with primary cortical networks, compared with the HCs. In addition, MDD patients also exhibited increased fluctuations in functional laterality in the thalamocortical system across the scan duration. The thalamo-subnetwork analysis unveiled abnormal dFC variability involving higher-order cortical networks in the MDD cohort. Significant correlations were found between increased dFC variability with dorsal attention and default mode networks and the severity of symptoms. Our study comprehensively investigated the pattern of alteration of the thalamocortical dFC in MDD patients. The heterogeneous alterations of dFC between the thalamus and both primary and higher-order cortical networks may help characterize the deficits of sensory and cognitive processing in MDD.

bioRxiv 2024-02-24 Preprint (No Snippets API) Nguyen-Dien GT, Townsend B, Kulkarni P, Kozul K, Ooi SS, Eldershaw D, Weeratunga S, Liu M, Jones MJ, Millard SS, Ng DC, Pagano M, Komander D, Lazarou M, Collins BM, Pagan JK.
Show Full Abstract

Mitophagy must be carefully regulated to ensure that cells maintain appropriate numbers of functional mitochondria. The SCF FBXL4 ubiquitin ligase complex suppresses mitophagy by controlling the degradation of BNIP3 and NIX mitophagy receptors, and FBXL4 mutations result in mitochondrial disease as a consequence of elevated mitophagy. Here, we reveal that the mitochondrial phosphatase PPTC7 is an essential cofactor for SCF FBXL4 -mediated destruction of BNIP3 and NIX, suppressing both basal and induced mitophagy. Disruption of the phosphatase activity of PPTC7 is not required for BNIP3 and NIX turnover. Rather, a pool of PPTC7 on the mitochondrial outer membrane acts as an adaptor linking BNIP3 and NIX to FBXL4, facilitating the turnover of these mitophagy receptors. PPTC7 accumulates on the outer mitochondrial membrane in response to mitophagy induction or the absence of FBXL4, suggesting a homeostatic feedback mechanism that attenuates high levels of mitophagy. We mapped critical residues required for PPTC7-NIX/BNIP3 and PPTC7-FBXL4 interactions and their disruption interferes with both NIX/BNIP3 degradation and mitophagy suppression. Collectively, these findings delineate a complex regulatory mechanism that restricts NIX/BNIP3-induced mitophagy.

HTT
Also flagged:gene expressionprotein synthesispathogenesistranslation factorsribosomeneurodegenerative diseases
Journal Article 2024-02-23 ✓ 1 Snippet Jia X, He X, Huang C, Li J, Dong Z, Liu K.
In-Text Gene Mentions

The pathogenesis of HD is attributed to an expanded CAG trinucleotide repeat in the HTT gene encoding huntingtin protein.

Show Full Abstract

Protein translation is a tightly regulated cellular process that is essential for gene expression and protein synthesis. The deregulation of this process is increasingly recognized as a critical factor in the pathogenesis of various human diseases. In this review, we discuss how deregulated translation can lead to aberrant protein synthesis, altered cellular functions, and disease progression. We explore the key mechanisms contributing to the deregulation of protein translation, including functional alterations in translation factors, tRNA, mRNA, and ribosome function. Deregulated translation leads to abnormal protein expression, disrupted cellular signaling, and perturbed cellular functions- all of which contribute to disease pathogenesis. The development of ribosome profiling techniques along with mass spectrometry-based proteomics, mRNA sequencing and single-cell approaches have opened new avenues for detecting diseases related to translation errors. Importantly, we highlight recent advances in therapies targeting translation-related disorders and their potential applications in neurodegenerative diseases, cancer, infectious diseases, and cardiovascular diseases. Moreover, the growing interest lies in targeted therapies aimed at restoring precise control over translation in diseased cells is discussed. In conclusion, this comprehensive review underscores the critical role of protein translation in disease and its potential as a therapeutic target. Advancements in understanding the molecular mechanisms of protein translation deregulation, coupled with the development of targeted therapies, offer promising avenues for improving disease outcomes in various human diseases. Additionally, it will unlock doors to the possibility of precision medicine by offering personalized therapies and a deeper understanding of the molecular underpinnings of diseases in the future.

Also flagged:Vestibular dysfunctioncognitive impairmentscognitionneurogenesisatrophydeath
Journal Article 2024-02-23 No Snippets Guo J, Wang J, Liang P, Tian E, Liu D, Guo Z, Chen J, Zhang Y, Zhou Z, Kong W, Crans DC, Lu Y, Zhang S.
Show Full Abstract

The vestibular system may have a critical role in the integration of sensory information and the maintenance of cognitive function. A dysfunction in the vestibular system has a significant impact on quality of life. Recent research has provided evidence of a connection between vestibular information and cognitive functions, such as spatial memory, navigation and attention. Although the exact mechanisms linking the vestibular system to cognition remain elusive, researchers have identified various pathways. Vestibular dysfunction may lead to the degeneration of cortical vestibular network regions and adversely affect synaptic plasticity and neurogenesis in the hippocampus, ultimately contributing to neuronal atrophy and cell death, resulting in memory and visuospatial deficits. Furthermore, the extent of cognitive impairment varies depending on the specific type of vestibular disease. In the present study, the current literature was reviewed, potential causal relationships between vestibular dysfunction and cognitive performance were discussed and directions for future research were proposed.

HTT
Also flagged:NeurodegenerationNeurodegenerative disorderschronic brain diseasespathogenesisnuclear factor erythroid 2-related factor 2Nrf2
Journal Article 2024-02-23 ✓ 5 Snippets Monsalvo-Maraver LA, Ovalle-Noguez EA, Nava-Osorio J, Maya-López M, Rangel-López E, Túnez I, Tinkov AA, Tizabi Y, Aschner M, Santamaría A, Students from Programa Delfín 2022.
In-Text Gene Mentions

In contrast, HD patients showed a decrease in CB1R activity in several gray matter regions, and that reduction was inversely correlated with the length of the polyglutamine coding region of the Htt gene (Van Laere et al. 2010).

This result is supported by the fact that rosiglitazone also reduced the aggregation of mutant Htt and that one of the PPARγ target genes is part of the proteasome activator complex (Chiang et al. 2015).

The first one reported that in N2a cells transfected with mutant Htt, activation of the cannabinoid-related receptor PPARγ by the agonist rosiglitazone rescued cell viability and diminished several markers of cell damage; however, rosiglitazone also enhanced the proteolytic activity of the proteasome.

Proteins such as amyloid-β (Aβ, related to AD), α-synuclein (α-Syn, related to PD), huntingtin (Htt, related to HD), and tau (related to AD and other tauopathies) have emerged as potential culprits regarding neurodegeneration.

…to PD), huntingtin (Htt, related to HD),…

Show Full Abstract

Neurodegenerative disorders are chronic brain diseases that affect humans worldwide. Although many different factors are thought to be involved in the pathogenesis of these disorders, alterations in several key elements such as the ubiquitin-proteasome system (UPS), the nuclear factor erythroid 2-related factor 2 (Nrf2) signaling pathway, and the endocannabinoid system (ECS or endocannabinoidome) have been implicated in their etiology. Impairment of these elements has been linked to the origin and progression of neurodegenerative disorders, while their potentiation is thought to promote neuronal survival and overall neuroprotection, as proved with several experimental models. These key neuroprotective pathways can interact and indirectly activate each other. In this review, we summarize the neuroprotective potential of the UPS, ECS, and Nrf2 signaling, both separately and combined, pinpointing their role as a potential therapeutic approach against several hallmarks of neurodegeneration.

Also flagged:synthesispodophyllotoxincancerwound healingtumoretoposide
Journal Article 2024-02-23 No Snippets Guo Y, Chen B, Guo J, Jiang P, Wang J, Sun W.
Show Full Abstract

<h4>Context</h4>Podophyllotoxin (PPT) derivatives, used in cancer therapy, require development toward enhanced efficacy and reduced toxicity.<h4>Objective</h4>This study synthesizes PPT derivatives to assess their anticancer activities.<h4>Materials and methods</h4>Compounds E1-E16 antiproliferative activity was tested against four human cancer cell lines (H446, MCF-7, HeLa, A549) and two normal cell lines (L02, BEAS-2B) using the CCK-8 assay. The effects of compound <b>E5</b> on A549 cell growth were evaluated through molecular docking, <i>in vitro</i> assays (flow cytometry, wound healing, Transwell, colony formation, Western blot), and <i>in vivo</i> tests in female BALB/c nude mice treated with <b>E5</b> (2 and 4 mg/kg). <b>E5</b> (4 mg/kg) significantly reduced xenograft tumor growth compared to the DMSO control group.<h4>Results</h4>Among the 16 PPT derivatives tested for cytotoxicity, <b>E5</b> exhibited potent effects against A549 cells (IC<sub>50</sub>: 0.35 ± 0.13 µM) and exceeded the reference drugs PPT and etoposide to inhibit the growth of xenograft tumours. <b>E5</b>-induced cell cycle arrest in the S and G2/M phases accelerated tubulin depolymerization and triggered apoptosis and mitochondrial depolarization while regulating the expression of apoptosis-related proteins and effectively inhibited cell migration and invasion, suggesting a potential to limit metastasis. Molecular docking showed binding of <b>E5</b> to tubulin at the colchicine site and to Akt, with a consequent down-regulation of PI3K/Akt pathway proteins.<h4>Discussion and conclusions</h4>This research lays the groundwork for advancing cancer treatment through developing and using PPT derivatives. The encouraging results associated with <b>E5</b> call for extended research and clinical validation, leading to novel and more effective cancer therapies.

Also flagged:chromatintranscription factorsCD8infectionT cell receptorspeptides
Journal Article 2024-02-23 No Snippets Watson NB, Patel RK, Kean C, Veazey J, Oyesola OO, Laniewski N, Grenier JK, Wang J, Tabilas C, Yee Mon KJ, McNairn AJ, Peng SA, Wesnak SP, Nzingha K, Davenport MP, Tait Wojno ED, Scheible KM, Smith NL, Grimson A, Rudd BD.
Show Full Abstract

CD8<sup>+</sup> T cells are classically recognized as adaptive lymphocytes based on their ability to recognize specific foreign antigens and mount memory responses. However, recent studies indicate that some antigen-inexperienced CD8<sup>+</sup> T cells can respond to innate cytokines alone in the absence of cognate T cell receptor stimulation, a phenomenon referred to as bystander activation. Here, we demonstrate that neonatal CD8<sup>+</sup> T cells undergo a robust and diverse program of bystander activation, which corresponds to enhanced innate-like protection against unrelated pathogens. Using a multi-omics approach, we found that the ability of neonatal CD8<sup>+</sup> T cells to respond to innate cytokines derives from their capacity to undergo rapid chromatin remodeling, resulting in the usage of a distinct set of enhancers and transcription factors typically found in innate-like T cells. We observed that the switch between innate and adaptive functions in the CD8<sup>+</sup> T cell compartment is mediated by changes in the abundance of distinct subsets of cells. The innate CD8<sup>+</sup> T cell subset that predominates in early life was also present in adult mice and humans. Our findings provide support for the layered immune hypothesis and indicate that the CD8<sup>+</sup> T cell compartment is more functionally diverse than previously thought.

Also flagged:dendrimersvesiclesacidslipidalkynecopper
Journal Article 2024-02-23 No Snippets Bristow P, Schantz K, Moosbrugger Z, Martin K, Liebenberg H, Steimle S, Xiao Q, Percec V, Wilner SE.
Show Full Abstract

Amphiphilic Janus dendrimers (JDs), synthetic alternatives to lipids, have the potential to expand the scope of nanocarrier delivery systems. JDs self-assemble into vesicles called dendrimersomes, encapsulate both hydrophobic cargo and nucleic acids, and demonstrate enhanced stability in comparison to lipid nanoparticles (LNPs). Here, we report the ability to enhance the cellular uptake of Janus dendrimersomes using DNA aptamers. Azido-modified JDs were synthesized and conjugated to alkyne-modified DNAs using copper-catalyzed azide alkyne cycloaddition. DNA-functionalized JDs form nanometer-sized dendrimersomes in aqueous solution via thin film hydration. These vesicles, now displaying short DNAs, are then hybridized to transferrin receptor binding DNA aptamers. Aptamer-targeted dendrimersomes show improved cellular uptake as compared to control vesicles via fluorescence microscopy and flow cytometry. This work demonstrates the versatility of using click chemistry to conjugate functionalized JDs with biologically relevant molecules and the feasibility of targeting DNA-modified dendrimersomes for drug delivery applications.

HTT
Also flagged:methylationSpinocerebellar ataxia subtype 37SCA37ataxiacerebellar syndromeDAB1
Journal Article 2024-02-23 ✓ 1 Snippet Sanchez-Flores M, Corral-Juan M, Gasch-Navalón E, Cirillo D, Sanchez I, Matilla-Dueñas A.
In-Text Gene Mentions

…(i.e. SCA1, SCA2,HTT, etc.) ,…

Show Full Abstract

Spinocerebellar ataxia subtype 37 (SCA37) is a rare disease originally identified in ataxia patients from the Iberian Peninsula with a pure cerebellar syndrome. SCA37 patients carry a pathogenic intronic (ATTTC)n repeat insertion flanked by two polymorphic (ATTTT)n repeats in the Disabled-1 (DAB1) gene leading to cerebellar dysregulation. Herein, we determine the precise configuration of the pathogenic 5'(ATTTT)n-(ATTTC)n-3'(ATTTT)n SCA37 alleles by CRISPR-Cas9 and long-read nanopore sequencing, reveal their epigenomic signatures in SCA37 lymphocytes, fibroblasts, and cerebellar samples, and establish new molecular and clinical correlations. The 5'(ATTTT)n-(ATTTC)n-3'(ATTTT)n pathogenic allele configurations revealed repeat instability and differential methylation signatures. Disease age of onset negatively correlated with the (ATTTC)n, and positively correlated with the 3'(ATTTT)n. Geographic origin and gender significantly correlated with age of onset. Furthermore, significant predictive regression models were obtained by machine learning for age of onset and disease evolution by considering gender, the (ATTTC)n, the 3'(ATTTT)n, and seven CpG positions differentially methylated in SCA37 cerebellum. A common 964-kb genomic region spanning the (ATTTC)n insertion was identified in all SCA37 patients analysed from Portugal and Spain, evidencing a common origin of the SCA37 mutation in the Iberian Peninsula originating 859 years ago (95% CI 647-1378). In conclusion, we demonstrate an accurate determination of the size and configuration of the regulatory 5'(ATTTT)n-(ATTTC)n-3'(ATTTT)n repeat tract, avoiding PCR bias amplification using CRISPR/Cas9-enrichment and nanopore long-read sequencing, resulting relevant for accurate genetic diagnosis of SCA37. Moreover, we determine novel significant genotype-phenotype correlations in SCA37 and identify differential cerebellar allele-specific methylation signatures that may underlie DAB1 pathogenic dysregulation.

Also flagged:peptideantibodiesantibodyADγ-secretasesproteinase
Journal Article 2024-02-23 No Snippets De Strooper B, Karran E.
Show Full Abstract

Two phase-III clinical trials with anti-amyloid peptide antibodies have met their primary goal, i.e. slowing of Alzheimer's disease (AD) progression. However, antibody therapy may not be the optimal therapeutic modality for AD prevention, as we will discuss in the context of the earlier small molecules described as "γ-secretase modulators" (GSM). We review here the structure, function, and pathobiology of γ-secretases, with a focus on how mutations in presenilin genes result in early-onset AD. Significant progress has been made in generating compounds that act in a manner opposite to pathogenic presenilin mutations: they stabilize the proteinase-substrate complex, thereby increasing the processivity of substrate cleavage and altering the size spectrum of Aβ peptides produced. We propose the term "γ-secretase allosteric stabilizers" (GSAS) to distinguish these compounds from the rather heterogenous class of GSM. The GSAS represent, in theory, a precision medicine approach to the prevention of amyloid deposition, as they specifically target a discrete aspect in a complex cell biological signalling mechanism that initiates the pathological processes leading to Alzheimer's disease.

TNFSF4
Also flagged:JAM3bladder cancerGene Expressionjunctional adhesion molecule 3calciumPI3K
Journal Article 2024-02-23 ✓ 1 Snippet Pang ZQ, Wang JS, Wang JF, Wang YX, Ji B, Xu YD, He JX, Zhang L, Zhang LQ, Ding BC, Liu Y, Ren MH.
In-Text Gene Mentions

…checkpoints CD200, NRP1,TNFSF4, and CD28, with…

Show Full Abstract

Understanding the intricate relationship between prognosis, immune function, and molecular markers in bladder cancer (BC) demands sophisticated analytical methods. To identify novel biomarkers for predicting prognosis and immune function in BC patients, we combined weighted gene co-expression network analysis (WGCNA) and least absolute shrinkage and selection operator (LASSO) regression analysis. This was conducted using data from The Cancer Genome Atlas (TCGA) and Gene Expression Omnibus (GEO) databases. Ultimately, we screened the junctional adhesion molecule 3 (JAM3) as an independent risk factor in BC. High levels of JAM3 were linked to adverse clinical parameters, such as higher T and N stages. Additionally, a JAM3-based nomogram model accurately predicted 1-, 3- and 5-year survival rates of BC patients, indicating potential clinical utility. Functional enrichment analysis revealed that high JAM3 expression activated the calcium signaling pathway, the extracellular matrix (ECM)-receptor interaction, and the PI3K-Akt signaling pathway, and was positively correlated with genes associated with epithelial-mesenchymal transition (EMT). Subsequently, we found that overexpression of JAM3 promoted the migration and invasion abilities in BC cells, regulating the expression levels of N-cadherin, matrix metallopeptidase 2 (MMP2), and Claudin-1 thereby promoting EMT levels. Additionally, we showed that JAM3 was negatively correlated with anti-tumor immune cells such as CD8+ T cells, while positively correlated with pro-tumor immune cells such as M2 macrophages, suggesting its involvement in immune cell infiltration. The immune checkpoint CD200 also showed a positive correlation with JAM3. Our findings revealed that elevated JAM3 levels are predictive of poor prognosis and immune cell infiltration in BC patients by regulating the EMT process.

PRDX6
Also flagged:Glycyrrhetinic acidnon-small cell lung cancermitochondrialNSCLCperoxiredoxin-6Casp3
Journal Article 2024-02-23 ✓ 4 Snippets Guo Q, Zhao M, Wang Q, Lu T, Luo P, Chen L, Xia F, Pang H, Shen S, Cheng G, Dai C, Meng Y, Zhong T, Qiu C, Wang J.
In-Text Gene Mentions

In vitro and in vivo results indicated GA significantly inhibited NSCLC via promotion of peroxiredoxin-6 (Prdx6) and caspase-3 (Casp3)-mediated mitochondrial apoptosis.

Glycyrrhetinic acid inhibits non-small cell lung cancer via promotion of Prdx6- and caspase-3-mediated mitochondrial apoptosis.

…via promotion ofPrdx6- and caspase-3-mediated mitoc…

…promotion of peroxiredoxin-6 (Prdx6) and caspase-3 (Casp3)-mediat…

Show Full Abstract

Glycyrrhetinic acid (GA) shows great efficiency against non-small cell lung cancer (NSCLC), but the detailed mechanism is unclear, which has limited its clinical application. Herein, we investigated the potential targets of GA against NSCLC by activity-based protein profiling (ABPP) technology and the combination of histopathology and proteomics validation. In vitro and in vivo results indicated GA significantly inhibited NSCLC via promotion of peroxiredoxin-6 (Prdx6) and caspase-3 (Casp3)-mediated mitochondrial apoptosis. This original finding will provide theoretical and data support to improve the treatment of NSCLC with the application of GA.

OLFM4
Also flagged:gene expressionTNFinflammatory bowel diseasesinfliximabadalimumabdefense response
Journal Article 2024-02-23 ✓ 2 Snippets Salvador-Martín S, Rubbini G, Vellosillo P, Zapata-Cobo P, Velasco M, Palomino LM, Clemente S, Segarra O, Moreno-Álvarez A, Fernández-Lorenzo A, Pérez-Moneo B, Montraveta M, Sánchez C, Tolín M, Loverdos I, Fobelo MJ, Navas-López VM, Magallares L, García-Romero R, Torres-Peral R, Rodríguez A, Bossacoma F, Merino-Bohórquez V, Salcedo E, Álvarez R, Dopazo A, Sanjurjo-Sáez M, López-Fernández LA.
In-Text Gene Mentions

Notably, 13 genes (CEACAM8, CEACAM6, CILP2, COL17A1, OLFM4, INHBA, LCN2, LTF, MMP8, DEFA4, PRTN3, AZU1, and ELANE) were selected for validation, and a consistent trend of increased expression in responders prior to drug administration was observed for most of these genes, with findings for 4 of them being statistically significant (CEACAM8, LCN2, LTF2, and PRTN3).<h4>Conclusions</h4>We identified 102 differentially expressed genes involved in the response to anti-TNF drugs in children with IBDs and validated CEACAM8, LCN2, LTF2, and PRTN3.

…CEACAM6, CILP2, COL17A1,OLFM4, INHBA, LCN2, LTF,…

Show Full Abstract

<h4>Background/aims</h4>Changes in gene expression profiles among individuals with inflammatory bowel diseases (IBDs) could potentially influence the responsiveness to anti-TNF treatment. The aim of this study was to identify genes that could serve as predictors of early response to anti-TNF therapies in pediatric IBD patients prior to the initiation of treatment.<h4>Methods</h4>We conducted a prospective, longitudinal, and multicenter study, enrolling 24 pediatric IBD patients aged less than 18 years who were initiating treatment with either infliximab or adalimumab. RNA-seq from blood samples was analyzed using the DESeq2 library by comparing responders and non-responders to anti-TNF drugs.<h4>Results</h4>Bioinformatic analyses unveiled 102 differentially expressed genes, with 99 genes exhibiting higher expression in responders compared to non-responders prior to the initiation of anti-TNF therapy. Functional enrichment analyses highlighted defense response to Gram-negative bacteria (FDR = 2.3 ×10-7) as the most significant biological processes, and hemoglobin binding (FDR = 0.002), as the most significant molecular function. Gene Set Enrichment Analysis (GSEA) revealed notable enrichment in transcriptional misregulation in cancer (FDR = 0.016). Notably, 13 genes (CEACAM8, CEACAM6, CILP2, COL17A1, OLFM4, INHBA, LCN2, LTF, MMP8, DEFA4, PRTN3, AZU1, and ELANE) were selected for validation, and a consistent trend of increased expression in responders prior to drug administration was observed for most of these genes, with findings for 4 of them being statistically significant (CEACAM8, LCN2, LTF2, and PRTN3).<h4>Conclusions</h4>We identified 102 differentially expressed genes involved in the response to anti-TNF drugs in children with IBDs and validated CEACAM8, LCN2, LTF2, and PRTN3. Genes participating in defense response to Gram-negative bacterium, serine-type endopeptidase activity, and transcriptional misregulation in cancer are good candidates for anticipating the response to anti-TNF drugs in children with IBDs.

Also flagged:deathrespiratory diseaseschronic obstructive pulmonary diseaseCOPDidiopathic pulmonary fibrosisacute respiratory distress syndrome
Journal Article 2024-02-23 No Snippets Chen Y, Li Z, Ji G, Wang S, Mo C, Ding BS.
Show Full Abstract

Lung tissue has a certain regenerative ability and triggers repair procedures after injury. Under controllable conditions, lung tissue can restore normal structure and function. Disruptions in this process can lead to respiratory system failure and even death, causing substantial medical burden. The main types of respiratory diseases are chronic obstructive pulmonary disease (COPD), idiopathic pulmonary fibrosis (IPF), and acute respiratory distress syndrome (ARDS). Multiple cells, such as lung epithelial cells, endothelial cells, fibroblasts, and immune cells, are involved in regulating the repair process after lung injury. Although the mechanism that regulates the process of lung repair has not been fully elucidated, clinical trials targeting different cells and signaling pathways have achieved some therapeutic effects in different respiratory diseases. In this review, we provide an overview of the cell type involved in the process of lung regeneration and repair, research models, and summarize molecular mechanisms involved in the regulation of lung regeneration and fibrosis. Moreover, we discuss the current clinical trials of stem cell therapy and pharmacological strategies for COPD, IPF, and ARDS treatment. This review provides a reference for further research on the molecular and cellular mechanisms of lung regeneration, drug development, and clinical trials.

TRIM38
Also flagged:SUMOylationLung adenocarcinomaLUADmalignant tumorsSmall Ubiquitin-like ModifierUBA2
Journal Article 2024-02-23 ✓ 5 Snippets Yu L, Lin N, Ye Y, Zhuang H, Zou S, Song Y, Chen X, Wang Q.
In-Text Gene Mentions

Elevated expression of TRIM28, SAE1, UBA2, RELA, and SLF1 was correlated with unfavorable prognosis, while higher expression of TRIM38, CAPN3, PWDD3, TRIM27, EGR2, and RNF212B was linked to favorable prognosis in LUAD patients.

Conversely, higher expression of Tripartite motif-containing 38 (TRIM38), Calpain 3 (CAPN3), Peptidylprolyl isomerase domain and WD repeat-containing protein 3 (PWDD3), Tripartite motif-containing 27 (TRIM27), Early growth response 2 (EGR2), and Ring finger protein 212B (RNF212B) was linked to favorable prognosis in LUAD patients (Figure 1B).

…ipartite motif-containing 38 (TRIM38), Calpain 3 (CAPN3),…

TRIM38and CAPN3 displayed…

…simultaneously detected inTRIM38, RELA, and SLF1,…

Show Full Abstract

Lung adenocarcinoma (LUAD) is one of the most common malignant tumors worldwide. Small Ubiquitin-like Modifier (SUMO)-ylation plays a crucial role in tumorigenesis. However, the SUMOylation pathway landscape and its clinical implications in LUAD remain unclear. Here, we analyzed genes involved in the SUMOylation pathway in LUAD and constructed a SUMOylation pathway signature (SUMOPS) using the LASSO-Cox regression model, validated in independent cohorts. Our analysis revealed significant dysregulation of SUMOylation-related genes in LUAD, comprising of favorable or unfavorable prognostic factors. The SUMOPS model was associated with established molecular and histological subtypes of LUAD, highlighting its clinical relevance. The SUMOPS stratified LUAD patients into SUMOPS-high and SUMOPS-low subtypes with distinct survival outcomes and adjuvant chemotherapy responses. The SUMOPS-low subtype showed favorable responses to adjuvant chemotherapy. The correlations between SUMOPS scores and immune cell infiltration suggested that patients with the SUMOPS-high subtype exhibited favorable immune profiles for immune checkpoint inhibitor (ICI) treatment. Additionally, we identified UBA2 as a key SUMOylation-related gene with an increased expression and a poor prognosis in LUAD. Cell function experiment confirmed the role of UBA2 in promoting LUAD cell proliferation, invasion, and migration. These findings provide valuable insights into the SUMOylation pathway and its prognostic implications in LUAD, paving the way for personalized treatment strategies and the development of novel therapeutic targets.

TNFSF4
Also flagged:colorectal cancercancersnecroptosiscancerTumormalignant tumor of the
Journal Article 2024-02-23 ✓ 1 Snippet Li M, Lu M, Li J, Gui Q, Xia Y, Lu C, Shu H.
In-Text Gene Mentions

…CD47, CD160, ADORA2A,TNFSF4, PDCD1 (PD-1), HAVCR2,…

Show Full Abstract

<h4>Background</h4>Necroptosis could regulate immunity in cancers, and stratification of colorectal cancer (CRC) subtypes based on key genes related to necroptosis might be a novel strategy for CRC treatment.<h4>Method</h4>The RNA-sequencing data of CRC and other 31 types of cancers were obtained from The Cancer Genome Atlas (TCGA) database. Consensus clustering was performed based on protein-coding genes (PCGs) related to necroptosis score calculated by single sample gene set enrichment analysis (ssGSEA). Module genes showing a significant positive correlation with the necroptosis score were identified by weighted correlation network analysis (WGCNA) and further used to develop a risk stratification model applying least absolute shrinkage and selection operator (LASSO) and Cox regression analysis. The risks score for each sample in CRC cohorts, immunotherapy cohorts and pan-cancer study cohorts was calculated.<h4>Result</h4>Two subgroups (C1 cluster and C2 cluster) of CRC were identified based on the necroptosis score. Compared with C1 cluster, the survival possibility of C2 cluster was greatly reduced, the levels of necroptosis score, immune cell infiltration, immune score and expression of immune checkpoint molecules were significantly increased and immunotherapy response was less active. Low-risk patients defined by the risk model had a significant survival advantage than high-risk counterparts in both CRC and the other 31 cancer types. Furthermore, the risk model was also more efficient than the Tumor Immune Dysfunction and Exclusion (TIDE) tool in predicting OS and immunotherapy response for the samples in the immunotherapy cohort.<h4>Conclusion</h4>CRC patients were classified by necroptosis score-related PCGs, and a risk model was designed to evaluate the immunotherapy and prognosis of patients with CRC. The current molecular subtype and prognostic model could help stratify patients with different risks and predict their prognosis and immunotherapy sensitivity.

SERPINC1
Also flagged:T lymphoblastic leukemialymphomaALLGene Expressionmitoticcell cycles
Journal Article 2024-02-23 ✓ 1 Snippet Ren Y, Liang H, Huang Y, Miao Y, Li R, Qiang J, Wu L, Qi J, Li Y, Xia Y, Huang L, Wang S, Kong X, Zhou Y, Zhang Q, Zhu G.
In-Text Gene Mentions

…(FIB), antithrombin III (ATIII), fibrinogen decomposition pr…

Show Full Abstract

T-cell acute lymphoblastic leukemia (T<i>-</i>ALL)/T-cell lymphoblastic lymphoma (T-LBL) is an uncommon but highly aggressive hematological malignancy. It has high recurrence and mortality rates and is challenging to treat. This study conducted bioinformatics analyses, compared genetic expression profiles of healthy controls with patients having T-ALL/T-LBL, and verified the results through serological indicators. Data were acquired from the GSE48558 dataset from Gene Expression Omnibus (GEO). T-ALL patients and normal T cells-related differentially expressed genes (DEGs) were investigated using the online analysis tool GEO2R in GEO, identifying 78 upregulated and 130 downregulated genes. Gene Ontology (GO) and protein-protein interaction (PPI) network analyses of the top 10 DEGs showed enrichment in pathways linked to abnormal mitotic cell cycles, chromosomal instability, dysfunction of inflammatory mediators, and functional defects in T-cells, natural killer (NK) cells, and immune checkpoints. The DEGs were then validated by examining blood indices in samples obtained from patients, comparing the T-ALL/T-LBL group with the control group. Significant differences were observed in the levels of various blood components between T-ALL and T-LBL patients. These components include neutrophils, lymphocyte percentage, hemoglobin (HGB), total protein, globulin, erythropoietin (EPO) levels, thrombin time (TT), D-dimer (DD), and C-reactive protein (CRP). Additionally, there were significant differences in peripheral blood leukocyte count, absolute lymphocyte count, creatinine, cholesterol, low-density lipoprotein, folate, and thrombin times. The genes and pathways associated with T-LBL/T-ALL were identified, and peripheral blood HGB, EPO, TT, DD, and CRP were key molecular markers. This will assist the diagnosis of T-ALL/T-LBL, with applications for differential diagnosis, treatment, and prognosis.

DARS2FBXL4
Also flagged:mitochondrial diseasesmitochondrialmitochondriapathogenesisMDphosphorylation
Journal Article 2024-02-23 ✓ 5 Snippets Nogueira C, Pereira C, Silva L, Laranjeira M, Lopes A, Neiva R, Rodrigues E, Campos T, Martins E, Bandeira A, Coelho M, Magalhães M, Damásio J, Gaspar A, Janeiro P, Gomes AL, Ferreira AC, Jacinto S, Vieira JP, Diogo L, Santos H, Mendonça C, Vilarinho L.
In-Text Gene Mentions

…NARS2 andDARS2cDNA were amplified…

…the SURF1 ,FBXL4, TSFM ,…

…variant in theDARS2, c.90C>A (p.Tyr30*),…

…that interact withDARS2, as shown…

…carrier of theDARS2variant, confirming the…

Show Full Abstract

<b>Introduction:</b> Rare disorders that are genetically and clinically heterogeneous, such as mitochondrial diseases (MDs), have a challenging diagnosis. Nuclear genes codify most proteins involved in mitochondrial biogenesis, despite all mitochondria having their own DNA. The development of next-generation sequencing (NGS) technologies has revolutionized the understanding of many genes involved in the pathogenesis of MDs. In this new genetic era, using the NGS approach, we aimed to identify the genetic etiology for a suspected MD in a cohort of 450 Portuguese patients. <b>Methods:</b> We examined 450 patients using a combined NGS strategy, starting with the analysis of a targeted mitochondrial panel of 213 nuclear genes, and then proceeding to analyze the whole mitochondrial DNA. <b>Results and Discussion:</b> In this study, we identified disease-related variants in 134 (30%) analyzed patients, 88 with nuclear DNA (nDNA) and 46 with mitochondrial DNA (mtDNA) variants, most of them being pediatric patients (66%), of which 77% were identified in nDNA and 23% in mtDNA. The molecular analysis of this cohort revealed 72 already described pathogenic and 20 novel, probably pathogenic, variants, as well as 62 variants of unknown significance. For this cohort of patients with suspected MDs, the use of a customized gene panel provided a molecular diagnosis in a timely and cost-effective manner. Patients who cannot be diagnosed after this initial approach will be further selected for whole-exome sequencing. <b>Conclusion:</b> As a national laboratory for the study and research of MDs, we demonstrated the power of NGS to achieve a molecular etiology, expanding the mutational spectrum and proposing accurate genetic counseling in this group of heterogeneous diseases without therapeutic options.

SERPINC1
Also flagged:extracellularvesiclesobesityhepatic steatosisC4C2
Journal Article 2024-02-23 ✓ 1 Snippet DiStefano JK, Piras IS, Wu X, Sharma R, Garcia-Mansfield K, Willey M, Lovell B, Pirrotte P, Olson ML, Shaibi GQ.
In-Text Gene Mentions

SERPINC1

Show Full Abstract

<h4>Background</h4>Recent studies suggest that proteomic cargo of extracellular vesicles (EVs) may play a role in metabolic improvements following lifestyle interventions. However, the relationship between changes in liver fat and circulating EV-derived protein cargo following intervention remains unexplored.<h4>Methods</h4>The study cohort comprised 18 Latino adolescents with obesity and hepatic steatosis (12 males/6 females; average age 13.3 ± 1.2 y) who underwent a six-month lifestyle intervention. EV size distribution and concentration were determined by light scattering intensity; EV protein composition was characterized by liquid chromatography tandem-mass spectrometry.<h4>Results</h4>Average hepatic fat fraction (HFF) decreased 23% by the end of the intervention (12.5% [5.5] to 9.6% [4.9]; P = 0.0077). Mean EV size was smaller post-intervention compared to baseline (120.2 ± 16.4 nm to 128.4 ± 16.5 nm; P = 0.031), although the difference in mean EV concentration (1.1E+09 ± 4.1E+08 particles/mL to 1.1E+09 ± 1.8E+08 particles/mL; P = 0.656)) remained unchanged. A total of 462 proteins were identified by proteomic analysis of plasma-derived EVs from participants pre- and post-intervention, with 113 proteins showing differential abundance (56 higher and 57 lower) between the two timepoints (adj-p <0.05). Pathway analysis revealed enrichment in complement cascade, initial triggering of complement, creation of C4 and C2 activators, and regulation of complement cascade. Hepatocyte-specific EV affinity purification identified 40 proteins with suggestive (p < 0.05) differential abundance between pre- and post-intervention samples.<h4>Conclusions</h4>Circulating EV-derived proteins, particularly those associated with the complement cascade, may contribute to improvements in liver fat in response to lifestyle intervention.

Also flagged:fatty acidtumorcolorectal cancerGene Expression5-fluorouracilirinotecan
Journal Article 2024-02-23 No Snippets Zou P, Chen C, Wu X.
Show Full Abstract

<h4>Background</h4>As one of the major metabolic reprogramming pathways, fatty acid oxidation (FAO) contributes to rapid progression in tumor cells. Nevertheless, the genomic patterns of patients' FAO levels in colorectal cancer (CRC) remain unknown. Hence, it is crucial to identify the interplay mechanisms of molecular biochemical features of FAO in CRC.<h4>Methods</h4>Data of patients with CRC were accessed from The Cancer Genome Atlas (TCGA). Unsupervised consensus clustering related to FAO sores was conducted. The differentially expressed genes (DEGs) were screened by clustering according to FAO status polarized in TCGA, followed by the construction of the scores of genes related to FAO (GFAO_Score). Enrichment of FAO and carcinogenesis at the cell level were calculated based on the single-cell RNA (scRNA) sequencing analysis. The clinical values and drug analysis of GFAO_Score were evaluated by external validation cohorts from Gene Expression Omnibus (GEO) datasets.<h4>Results</h4>We classified patients into two distinct FAO clusters which indicated those with lower FAO levels had poor prognosis and high enrichment of carcinogenic-gene pathways. Further, the high FAO-enriched subtypes in epithelial cells revealed carcinogenesis. Three FAO-related genes (<i>ZFHX4</i>, <i>AQP8</i>, and <i>AKR1B10</i>) were screened to construct the GFAO_Score. The high GFAO_Score group leaned toward advanced CRC and unfavorable survival outcomes in the validation cohort. The low GFAO_Score group possessed a better response to immunotherapy and exhibited lower IC50 (50% inhibition concentration) values for certain chemotherapy drugs, such as 5-fluorouracil, irinotecan, oxaliplatin, paclitaxel, and camptothecin.<h4>Conclusions</h4>FAO patterns vary in patients with CRC. The GFAO_Score might contribute to the precise screening of patients according to metabolism reprogramming and optimization of strategies in clinical practice.

Also flagged:Oxygenosteoarthritisagingmetabolismmusculoskeletal diseasesOA
Journal Article 2024-02-23 No Snippets Lammi MJ, Qu C.
Show Full Abstract

Cartilage defects and osteoarthritis are health problems which are major burdens on health care systems globally, especially in aging populations. Cartilage is a vulnerable tissue, which generally faces a progressive degenerative process when injured. This makes it the 11th most common cause of global disability. Conservative methods are used to treat the initial phases of the illness, while orthopedic management is the method used for more progressed phases. These include, for instance, arthroscopic shaving, microfracturing and mosaicplasty, and joint replacement as the final treatment. Cell-based implantation methods have also been developed. Despite reports of successful treatments, they often suffer from the non-optimal nature of chondrocyte phenotype in the repair tissue. Thus, improved strategies to control the phenotype of the regenerating cells are needed. Avascular tissue cartilage relies on diffusion for nutrients acquisition and the removal of metabolic waste products. A low oxygen content is also present in cartilage, and the chondrocytes are, in fact, well adapted to it. Therefore, this raises an idea that the regulation of oxygen tension could be a strategy to control the chondrocyte phenotype expression, important in cartilage tissue for regenerative purposes. This narrative review discusses the aspects related to oxygen tension in the metabolism and regulation of articular and growth plate chondrocytes and progenitor cell phenotypes, and the role of some microenvironmental factors as regulators of chondrocytes.

Also flagged:OleuropeinHydroxytyrosolCancerMetabolismpolyphenolsSecoiridoid oleuropein
Journal Article 2024-02-23 No Snippets Gervasi F, Pojero F.
Show Full Abstract

The fact that the Mediterranean diet could represent a source of natural compounds with cancer-preventive and therapeutic activity has been the object of great interest, especially with regard to the mechanisms of action of polyphenols found in olive oil and olive leaves. Secoiridoid oleuropein (OLE) and its derivative hydroxytyrosol (3,4-dihydroxyphenylethanol, HT) have demonstrated anti-proliferative properties against a variety of tumors and hematological malignancies both in vivo and in vitro, with measurable effects on cellular redox status, metabolism, and transcriptional activity. With this review, we aim to summarize the most up-to-date information on the potential use of OLE and HT for cancer treatment, making important considerations about OLE and HT bioavailability, OLE- and HT-mediated effects on drug metabolism, and OLE and HT dual activity as both pro- and antioxidants, likely hampering their use in clinical routine. Also, we focus on the details available on the effects of nutritionally relevant concentrations of OLE and HT on cell viability, redox homeostasis, and inflammation in order to evaluate if both compounds could be considered cancer-preventive agents or new potential chemotherapy drugs whenever their only source is represented by diet.

HTT
Also flagged:Smith-Lemli-Opitz Syndromegenetic developmental disordercholesterolbiosynthesismicrocephalyamnesia
Journal Article 2024-02-23 ✓ 1 Snippet Yılmaz M, Bebek O, Turkyilmaz A.
In-Text Gene Mentions

HTT

Show Full Abstract

<h4>Introduction</h4>Smith-Lemli-Opitz syndrome (SLOS), a genetic developmental disorder characterized by various congenital anomalies, arises from a loss of normal <i>DHCR7</i> enzymatic action in cholesterol biosynthesis. This syndrome is typically marked by various congenital anomalies, including microcephaly with cognitive impairments, distinctive facial features, and syndactyly of the toes (2-3 fusion).<h4>Case presentation</h4>A 73-year-old woman, followed up on by the neurology clinic for the last 3 years for amnesia and movement disorders, was referred to our clinic for genetic etiology investigation. Although there were no significant dysmorphic findings on her physical examination, observations included partial syndactyly between the second and third toes of both feet, a wide forehead, and a triangular face. We used the whole-exome sequencing (WES) analysis to evaluate the patient because of their various phenotype, which included dysmorphic features, movement problems, recurrent hip dislocation, mild intellectual impairment. WES analysis revealed a homozygous missense c.1295A>G (p.Tyr432Cys) variation in <i>DHCR7</i> gene.<h4>Discussion</h4>A total of 9 patients with p.Tyr432Cys variant have been reported in the literature so far. The present case is the first patient with biallelic c.1295A>G (p.Tyr432Cys) variation in <i>DHCR7</i> gene in the current literature. Diagnosing the disorder can be challenging, particularly in its milder manifestations, given the extensive range of clinical presentations. The present case is the oldest patient with SLOS reported in the relevant literature. Mild dysmorphic features, mild intellectual disability, and recurrent hip dislocation, along with the typical finding of syndactyly between the second and third toes in the foot, may indicate mild forms of SLOS.

bioRxiv 2024-02-23 Preprint (No Snippets API) Qiu J, Voliotis M, Bosch MA, Li XF, Zweifel LS, Tsaneva-Atanasova K, O’Byrne KT, Rønnekleiv OK, Kelly MJ.
Show Full Abstract

Hypothalamic kisspeptin (Kiss1) neurons are vital for pubertal development and reproduction. Arcuate nucleus Kiss1 (Kiss1 ARH ) neurons are responsible for the pulsatile release of Gonadotropin-releasing Hormone (GnRH). In females, the behavior of Kiss1 ARH neurons, expressing Kiss1, Neurokinin B (NKB), and Dynorphin (Dyn), varies throughout the ovarian cycle. Studies indicate that 17β-estradiol (E2) reduces peptide expression but increases Vglut2 mRNA and glutamate neurotransmission in these neurons, suggesting a shift from peptidergic to glutamatergic signaling. To investigate this shift, we combined transcriptomics, electrophysiology, and mathematical modeling. Our results demonstrate that E2 treatment upregulates the mRNA expression of voltage-activated calcium channels, elevating the whole-cell calcium current and that contribute to high-frequency burst firing. Additionally, E2 treatment decreased the mRNA levels of Canonical Transient Receptor Potential (TPRC) 5 and G protein-coupled K + (GIRK) channels. When TRPC5 channels in Kiss1 ARH neurons were deleted using CRISPR, the slow excitatory postsynaptic potential (sEPSP) was eliminated. Our data enabled us to formulate a biophysically realistic mathematical model of the Kiss1 ARH neuron, suggesting that E2 modifies ionic conductances in Kiss1 ARH neurons, enabling the transition from high frequency synchronous firing through NKB-driven activation of TRPC5 channels to a short bursting mode facilitating glutamate release. In a low E2 milieu, synchronous firing of Kiss1 ARH neurons drives pulsatile release of GnRH, while the transition to burst firing with high, preovulatory levels of E2 would facilitate the GnRH surge through its glutamatergic synaptic connection to preoptic Kiss1 neurons.

OLFM4
Also flagged:ulcerative colitistissue remodelingMHTGF-βIL )IL-6
Journal Article 2024-02-22 ✓ 5 Snippets Jun YK, Kim N, Yoon H, Park JH, Kim HK, Choi Y, Lee JA, Shin CM, Park YS, Lee DH.
In-Text Gene Mentions

Mucosal healing (MH) was defined according to a Mayo endoscopic score of 0, 1 or non-MH (Mayo endoscopic score of 2 or 3).<h4>Results</h4>: The messenger RNA expressions of <i>TGF-β</i>, <i>IL-1β</i>, <i>OLFM4</i>, <i>FSP1</i>, <i>vimentin</i>, and <i>α-SMA</i> were significantly higher, and that of <i>E-cadherin</i> was significantly lower in inflamed and uninflamed regions of patients with UC than those in controls.

…, olfactomedin-4 (OLFM4), leucine-rich repeat-contain…

…, IL-1β ,OLFM4, FSP1 ,…

…and that ofOLFM4, FSP1 ,…

…( E-cadherin, p=0.002;OLFM4, p=0.001; FSP1,…

Show Full Abstract

<h4>Background/aims</h4>: The genetic expression in the active inflammatory regions is increased in ulcerative colitis (UC) with endoscopic activity. The aim of this study was to investigate the molecular activity of inflammation and tissue remodeling markers in endoscopically inflamed and uninflamed regions of UC.<h4>Methods</h4>: Patients with UC (n=47) and controls (n=20) were prospectively enrolled at the Seoul National University Bundang Hospital. Inflamed tissue was obtained at the most active lesion, and uninflamed tissue was collected from approximately 15 cm above the upper end of the active lesion via colonoscopic biopsies. The messenger RNA expression levels of transforming growth factor β (<i>TGF-β</i>), interleukin (<i>IL)-1β</i>, <i>IL-6</i>, <i>IL-17A</i>, <i>E-cadherin</i>, olfactomedin-4 (<i>OLFM4</i>), leucine-rich repeat-containing G protein-coupled receptor 5 (<i>LGR5</i>), <i>vimentin</i>, fibroblast-specific protein-1 (<i>FSP1</i>), and α-smooth muscle actin (<i>SMA</i>) were evaluated. Mucosal healing (MH) was defined according to a Mayo endoscopic score of 0, 1 or non-MH (Mayo endoscopic score of 2 or 3).<h4>Results</h4>: The messenger RNA expressions of <i>TGF-β</i>, <i>IL-1β</i>, <i>OLFM4</i>, <i>FSP1</i>, <i>vimentin</i>, and <i>α-SMA</i> were significantly higher, and that of <i>E-cadherin</i> was significantly lower in inflamed and uninflamed regions of patients with UC than those in controls. In the inflamed regions, patients in the non-MH group had significantly increased genetic expression of <i>TGF-β</i>, <i>FSP1</i>, <i>vimentin</i>, and <i>α-SMA</i> compared to patients in the MH group. Similarly, the non-MH group had significantly higher genetic expression of <i>TGF-β</i>, <i>IL-1β</i>, <i>IL-6</i>, <i>vimentin</i>, and <i>α-SMA</i> than the MH group in the uninflamed regions.<h4>Conclusions</h4>: Endoscopic activity in UC suggests inflammation and tissue remodeling of uninflamed regions similar to inflamed regions (ClinicalTrials.gov, NCT05653011).

POU3F2
Also flagged:RFX4neuropsychiatric disordersCas9NEUROD1schizophreniachromatin
Journal Article 2024-02-22 ✓ 5 Snippets Choi W, Choe MS, Kim SM, Kim SJ, Lee J, Lee Y, Lee SM, Dho SH, Lee MY, Kim LK.
In-Text Gene Mentions

…the promoters ofPOU3F2and NEUROD1.…

…of proneural genesPOU3F2and NEUROD1…

…factors, which comprisePOU3F2, ASCL1, and MYT1L,…

…to promoters ofPOU3F2and NEUROD1, also…

…factors such asPOU3F2, ASCL1, and NEUROD1…

Show Full Abstract

Proneural genes play a crucial role in neuronal differentiation. However, our understanding of the regulatory mechanisms governing proneural genes during neuronal differentiation remains limited. RFX4, identified as a candidate regulator of proneural genes, has been reported to be associated with the development of neuropsychiatric disorders. To uncover the regulatory relationship, we utilized a combination of multi-omics data, including ATAC-seq, ChIP-seq, Hi-C, and RNA-seq, to identify RFX4 as an upstream regulator of proneural genes. We further validated the role of RFX4 using an in vitro model of neuronal differentiation with RFX4 knock-in and a CRISPR-Cas9 knock-out system. As a result, we found that RFX4 directly interacts with the promoters of POU3F2 and NEUROD1. Transcriptomic analysis revealed a set of genes associated with neuronal development, which are highly implicated in the development of neuropsychiatric disorders, including schizophrenia. Notably, ectopic expression of RFX4 can drive human embryonic stem cells toward a neuronal fate. Our results strongly indicate that RFX4 serves as a direct upstream regulator of proneural genes, a role that is essential for normal neuronal development. Impairments in RFX4 function could potentially be related to the development of various neuropsychiatric disorders. However, understanding the precise mechanisms by which the RFX4 gene influences the onset of neuropsychiatric disorders requires further investigation through human genetic studies.

DCC
Also flagged:Cabozantinibmetastatic renal cell carcinomatumorsRCCPBRM1SETD2
Journal Article 2024-02-22 ✓ 1 Snippet Borkowetz A, Sommer U, Baretton G, Gruellich C, Bürk BT, Erb HHH, Thomas C, MORECAB Consortium.
In-Text Gene Mentions

…SYNE1 , andDCCseem predictive for…

Show Full Abstract

<h4>Purpose</h4>Cabozantinib (CAB) as monotherapy or in combination with immune checkpoint inhibitors is used for systemic treatment of metastatic renal cell carcinoma (mRCC). However, little is known about predictors of treatment response to CAB. For this reason, known genomic drivers were examined to identify potential predictors of treatment response with CAB.<h4>Methods</h4>Twenty mRCC patients receiving monotherapy (≥ first-line) with CAB were prospectively included. DNA was extracted from archived primary tumors or metastatic tissue. Targeted DNA sequencing was performed using a gene panel including 328 genes (QIAseq Targeted DNA V3 Panel, Qiagen). The variant evaluation was performed using Varsome. The endpoints were treatment-failure-free-survival (TFFS) to CAB.<h4>Results</h4>26% of patients received systemic RCC treatment as the primary option. Six patients were treated with CAB in first-line (1L) and 12 patients in ≥ 2L. The median follow-up after initiation of systemic treatment was 26.7 months (mo). The PBRM1 (7 alleles), SETD2 (7 alleles), VHL (11 alleles), and CHEK2 (14 alleles) genes were most frequently altered. The median time to TFFS was 10.5 mo (95% confidence interval (CI) 6.2-14.7 mo). There was a longer treatment response to CAB in patients with alterations of the SETD2 gene (SETD2 alteration median TFFS not reached vs. no SETD2 alterations 8.4 mo (95% CI 5.2-11.6 mo); p = 0.024).<h4>Conclusion</h4>Pathogenic variant genes may indicate treatment response to systemic therapy in mRCC. Patients with alterations of the SETD2 gene show longer responses to CAB treatment.

Also flagged:CancerPeptideNeoantigenstumormonophosphoryl lipid Aimmune response
Journal Article 2024-02-22 No Snippets Baljon JJ, Kwiatkowski AJ, Pagendarm HM, Stone PT, Kumar A, Bharti V, Schulman JA, Becker KW, Roth EW, Christov PP, Joyce S, Wilson JT.
Show Full Abstract

Immune checkpoint blockade (ICB) has revolutionized cancer treatment and led to complete and durable responses, but only for a minority of patients. Resistance to ICB can largely be attributed to insufficient number and/or function of antitumor CD8<sup>+</sup> T cells in the tumor microenvironment. Neoantigen targeted cancer vaccines can activate and expand the antitumor T cell repertoire, but historically, clinical responses have been poor because immunity against peptide antigens is typically weak, resulting in insufficient activation of CD8<sup>+</sup> cytotoxic T cells. Herein, we describe a nanoparticle vaccine platform that can overcome these barriers in several ways. First, the vaccine can be reproducibly formulated using a scalable confined impingement jet mixing method to coload a variety of physicochemically diverse peptide antigens and multiple vaccine adjuvants into pH-responsive, vesicular nanoparticles that are monodisperse and less than 100 nm in diameter. Using this approach, we encapsulated synergistically acting adjuvants, cGAMP and monophosphoryl lipid A (MPLA), into the nanocarrier to induce a robust and tailored innate immune response that increased peptide antigen immunogenicity. We found that incorporating both adjuvants into the nanovaccine synergistically enhanced expression of dendritic cell costimulatory markers, pro-inflammatory cytokine secretion, and peptide antigen cross-presentation. Additionally, the nanoparticle delivery increased lymph node accumulation and uptake of peptide antigen by dendritic cells in the draining lymph node. Consequently, nanoparticle codelivery of peptide antigen, cGAMP, and MPLA enhanced the antigen-specific CD8<sup>+</sup> T cell response and delayed tumor growth in several mouse models. Finally, the nanoparticle platform improved the efficacy of ICB immunotherapy in a murine colon carcinoma model. This work establishes a versatile nanoparticle vaccine platform for codelivery of peptide neoantigens and synergistic adjuvants to enhance responses to cancer vaccines.

OLFM4
Also flagged:digestionintestinal diseasesinflammatory bowel diseasescancercarbohydratesmetabolism
Journal Article 2024-02-22 ✓ 1 Snippet Shi R, Wang B.
In-Text Gene Mentions

…but also increasesOLFM4+ stem cells…

Show Full Abstract

Intestinal stem cells (ISCs) are known for their remarkable proliferative capacity, making them one of the most active cell populations in the body. However, a high turnover rate of intestinal epithelium raises the likelihood of dysregulated homeostasis, which is known to cause various diseases, including cancer. Maintaining precise control over the homeostasis of ISCs is crucial to preserve the intestinal epithelium's integrity during homeostasis or stressed conditions. Recent research has indicated that nutrients and metabolic pathways can extensively modulate the fate of ISCs. This review will explore recent findings concerning the influence of various nutrients, including lipids, carbohydrates, and vitamin D, on the delicate balance between ISC proliferation and differentiation.

Also flagged:UreaNitrogenAlbuminDiabetic KetoacidosisDiabetes mellitusmetabolic disorder
Journal Article 2024-02-22 No Snippets Hang T, Huang J, He G, Li J, Tao T.
Show Full Abstract

<h4>Objective</h4>To investigate the predictive value of the blood urea nitrogen to serum albumin ratio for in-hospital and out-of-hospital mortality in critically ill patients with diabetic ketoacidosis.<h4>Methods</h4>Data were obtained from the Medical Information Mart for Intensive Care III (MIMIC III) database, and all eligible participants were categorized into two groups based on the BAR cutoff value. Multiple logistic regression analysis was conducted to determine the association between BAR and in-hospital mortality. The Kaplan-Meier (K-M) analysis was performed to evaluate the predictive performance of BAR. Propensity score matching (PSM) was applied to control confounding factors between the low and high BAR groups.<h4>Results</h4>A total of 589 critically ill patients with diabetic ketoacidosis were enrolled. Patients with diabetic ketoacidosis with a higher BAR level were associated with higher in- and out-hospital mortality (all p<0.001). A significant 4-year survival difference was observed between the low and high BAR groups (p<0.0001). After PSM analysis, two PSM groups (202 pairs, n=404) were generated, and similar results were observed in the K-M curve (p<0.0001).<h4>Discussion</h4>Elevated BAR levels were associated with an increased risk of in-hospital mortality in critically ill patients with diabetic ketoacidosis, and BAR could serve as an independent prognostic factor in in-hospital and out-of-hospital mortality for patients diagnosed with diabetic ketoacidosis.

B4GALT5
Also flagged:diseases of thepancreasdiabetesGene expressionimpaired glucose tolerancemetabolism
Journal Article 2024-02-22 ✓ 1 Snippet Wang Z, Zhang G, Fu J, Li G, Zhao Z, Choe H, Ding K, Ma J, Wei J, Shang D, Zhang L.
In-Text Gene Mentions

…DTX3L, IFNGR2, KCTD10,B4GALT5, and B2M) and…

Show Full Abstract

The damage to the endocrine pancreas among patients with diseases of the exocrine pancreas (DP) leads to reduced glycemic deterioration, ultimately resulting in diabetes of the exocrine pancreas (DEP). The present research aims to investigate the mechanism responsible for glycemic deterioration in DP patients, and to identify useful biomarkers, with the ultimate goal of enhancing clinical practice awareness. Gene expression profiles of patients with DP in this study were acquired from the Gene Expression Omnibus database. The original study defines DP patients to belong in one of three categories: non-diabetic (ND), impaired glucose tolerance (IGT) and DEP, which correspond to normoglycemia, early and late glycemic deterioration, respectively. After ensuring quality control, the discovery cohort included 8 ND, 20 IGT, and 12 DEP, while the validation cohort included 27 ND, 15 IGT, and 20 DEP. Gene set enrichment analysis (GSEA) employed differentially expressed genes (DEGs), while immunocyte infiltration was determined using single sample gene set enrichment analysis (ssGSEA). Additionally, correlation analysis was conducted to establish the link between clinical characteristics and immunocyte infiltration. The least absolute shrinkage and selection operator regression and random forest combined to identify biomarkers indicating glycemic deterioration in DP patients. These biomarkers were further validated through independent cohorts and animal experiments. With glycemic deterioration, biological processes in the pancreatic islets such as nutrient metabolism and complex immune responses are disrupted in DP patients. The expression of ACOT4, B2M, and ACKR2 was upregulated, whereas the expression of CACNA1F was downregulated. Immunocyte infiltration in the islet microenvironment showed a significant positive correlation with the age, body mass index (BMI), HbA1c and glycemia at the 2-h of patients. It was a crucial factor in glycemic deterioration. Additionally, B2M demonstrated a significant positive correlation with immunocyte infiltration and clinical features. Quantitative real-time PCR (qRT-PCR) and western blotting confirmed the upregulation in B2M. Immunofluorescent staining suggested the alteration of B2M was mainly in the alpha cells and beta cells. Overall, the study showed that gradually increased immunocyte infiltration was a significant contributor to glycemic deterioration in patients with DP, and it also highlighted B2M as a biomarker.

CACNA1E
Also flagged:Parkinsonism‐dystonia‐2PKDYS2developmental delayParkinsonismdystoniaautonomic dysfunction
Journal Article 2024-02-22 ✓ 1 Snippet Almuqbil MA, Tabassum S, Muthaffar OY, Ghamdi F, Al Masseri Z, Alsaman A, Alkhater RA.
In-Text Gene Mentions

…genes were found:CACNA1E, c.3214G>A p. Val1072Ile,…

Show Full Abstract

Parkinsonism-dystonia-2 PKDYS2 is an autosomal-recessive disorder, caused by pathogenic biallelic variants in SLC18A2 which encodes the vesicular monoamine transporter (VMAT2) protein. PKDYS2 is a treatable neurotransmitter disease, and the rate of diagnosis of this disorder has increased significantly with the advance of genomic technologies. Our report highlights a novel pathologic variant in one case and a novel finding on MRI Brain, consisting of a normal symmetrical signal intensity in the dorsal brainstem and pons, and it substantiates the significance of genetic testing in the evaluation of children with developmental delays, which influences clinical decisions to enhance patient outcomes.

Also flagged:RNA helicasemetabolismchromatinribosomepolymerase IIfertilization
Journal Article 2024-02-22 No Snippets Lee H, Han DW, Yoo S, Kwon O, La H, Park C, Lee H, Kang K, Uhm SJ, Song H, Do JT, Choi Y, Hong K.
Show Full Abstract

<h4>Objective</h4>R-loops are DNA:RNA triplex hybrids, and their metabolism is tightly regulated by transcriptional regulation, DNA damage response, and chromatin structure dynamics. R-loop homeostasis is dynamically regulated and closely associated with gene transcription in mouse zygotes. However, the factors responsible for regulating these dynamic changes in the R-loops of fertilized mouse eggs have not yet been investigated. This study examined the functions of candidate factors that interact with R-loops during zygotic gene activation.<h4>Methods</h4>In this study, we used publicly available next-generation sequencing datasets, including low-input ribosome profiling analysis and polymerase II chromatin immunoprecipitation-sequencing (ChIP-seq), to identify potential regulators of R-loop dynamics in zygotes. These datasets were downloaded, reanalyzed, and compared with mass spectrometry data to identify candidate factors involved in regulating R-loop dynamics. To validate the functions of these candidate factors, we treated mouse zygotes with chemical inhibitors using in vitro fertilization. Immunofluorescence with an anti-R-loop antibody was then performed to quantify changes in R-loop metabolism.<h4>Results</h4>We identified DEAD-box-5 (DDX5) and histone deacetylase-2 (HDAC2) as candidates that potentially regulate R-loop metabolism in oocytes, zygotes and two-cell embryos based on change of their gene translation. Our analysis revealed that the DDX5 inhibition of activity led to decreased R-loop accumulation in pronuclei, indicating its involvement in regulating R-loop dynamics. However, the inhibition of histone deacetylase-2 activity did not significantly affect R-loop levels in pronuclei.<h4>Conclusion</h4>These findings suggest that dynamic changes in R-loops during mouse zygote development are likely regulated by RNA helicases, particularly DDX5, in conjunction with transcriptional processes. Our study provides compelling evidence for the involvement of these factors in regulating R-loop dynamics during early embryonic development.

SERPINC1
Also flagged:congenital syphilisSyphilisCScerebral palsyhydrocephalushearing
Journal Article 2024-02-22 ✓ 1 Snippet Muzi G, Ferrara D, Mamone R, D'Auria D, Ranucci G, Quitadamo P, Zeccolini M, Parisi P, Esposito F.
In-Text Gene Mentions

…products, plasma, andATIII).…

Show Full Abstract

Syphilis is caused by treponema pallidum. If untreated, or inadequately treated, during pregnancy, it can result in congenital syphilis (CS), which is classified as early and late. Early CS displays before 2 years of age. We herein describe 2 cases of early CS, whose clinical onset included liver failure, edema, organomegaly, and respiratory distress. We focus on liver, intestinal, and brain ultrasound (US) and other peculiar radiological findings. To date, there are no scientific data on intestinal and brain US findings in patients with early CS whereas data on abdominal US are scarce. Increasing knowledge about US findings in early CS could be useful to improve the diagnostic and therapeutic approach to these patients.

MLLT10
Also flagged:CD19antibodyCD47acute lymphoblastic leukemiaALLIl2rg
Journal Article 2024-02-22 ✓ 1 Snippet Schewe DM, Vogiatzi F, Münnich IA, Zeller T, Windisch R, Wichmann C, Müller K, Bhat H, Felix E, Mougiakakos D, Bruns H, Lenk L, Valerius T, Humpe A, Peipp M, Kellner C.
In-Text Gene Mentions

…ALL #4] and KMT2A::MLLT10[sample Ped ALL…

Show Full Abstract

CD19-directed immunotherapy has become a cornerstone in the therapy of B-cell precursor acute lymphoblastic leukemia (BCP-ALL). CD19-directed cellular and antibody-based therapeutics have entered therapy of primary and relapsed disease and contributed to improved outcomes in relapsed disease and lower therapy toxicity. However, efficacy remains limited in many cases due to a lack of therapy response, short remission phases, or antigen escape. Here, BCP-ALL cell lines, patient-derived xenograft (PDX) samples, human macrophages, and an in vivo transplantation model in NOD.Cg-Prkdc<sup>scid</sup>Il2rg<sup>tm1Wjl</sup>/SzJ (NSG) mice were used to examine the therapeutic potency of a CD19 antibody Fc-engineered for improved effector cell recruitment (CD19-DE) and antibody-dependent cellular phagocytosis (ADCP), in combination with a novel modified CD47 antibody (Hu5F9-IgG2σ). For the in vivo model, only samples refractory to CD19-DE monotherapy were chosen. Hu5F9-IgG2σ enhanced ADCP by CD19-DE in various BCP-ALL cell line models with varying CD19 surface expression and cytogenetic backgrounds, two of which contained the <i>KMT2A-AFF1</i> fusion. Also, the antibody combination was efficient in inducing ADCP by human macrophages in pediatric PDX samples with and adult samples with and without <i>KMT2A</i>-rearrangement in vitro. In a randomized phase 2-like PDX trial using seven <i>KMT2A</i>-rearranged BCP-ALL samples in NSG mice, the CD19/CD47 antibody combination proved highly efficient. Our findings support that the efficacy of Fc-engineered CD19 antibodies may be substantially enhanced by a combination with CD47 blockade. This suggests that the combination may be a promising therapy option for BCP-ALL, especially in relapsed patients and/or patients refractory to CD19-directed therapy.

HTT
Also flagged:autophagydegradationsynapsebehavioralneurological diseasesautism
Journal Article 2024-02-22 ✓ 1 Snippet Bai I, Keyser C, Zhang Z, Rosolia B, Hwang JY, Zukin RS, Yan J.
In-Text Gene Mentions

In Huntington’s disease (HD), DNMT1 knockdown has been shown to strengthen autophagy and reduce Huntington (HTT)-induced neural cytotoxicity (118).

Show Full Abstract

Autophagy is a conserved cellular mechanism that enables the degradation and recycling of cellular organelles and proteins <i>via</i> the lysosomal pathway. In neurodevelopment and maintenance of neuronal homeostasis, autophagy is required to regulate presynaptic functions, synapse remodeling, and synaptic plasticity. Deficiency of autophagy has been shown to underlie the synaptic and behavioral deficits of many neurological diseases such as autism, psychiatric diseases, and neurodegenerative disorders. Recent evidence reveals that dysregulated autophagy plays an important role in the initiation and progression of neuroinflammation, a common pathological feature in many neurological disorders leading to defective synaptic morphology and plasticity. In this review, we will discuss the regulation of autophagy and its effects on synapses and neuroinflammation, with emphasis on how autophagy is regulated by epigenetic mechanisms under healthy and diseased conditions.

Also flagged:Proteasesubiquitinubiquitin-like proteinscancercardiac disordersdeubiquitinases
Journal Article 2024-02-22 No Snippets Campos Alonso M, Knobeloch KP.
Show Full Abstract

Proteases that cleave ubiquitin or ubiquitin-like proteins (UBLs) are critical players in maintaining the homeostasis of the organism. Concordantly, their dysregulation has been directly linked to various diseases, including cancer, neurodegeneration, developmental aberrations, cardiac disorders and inflammation. Given their potential as novel therapeutic targets, it is essential to fully understand their mechanisms of action. Traditionally, observed effects resulting from deficiencies in deubiquitinases (DUBs) and UBL proteases have often been attributed to the misregulation of substrate modification by ubiquitin or UBLs. Therefore, much research has focused on understanding the catalytic activities of these proteins. However, this view has overlooked the possibility that DUBs and UBL proteases might also have significant non-catalytic functions, which are more prevalent than previously believed and urgently require further investigation. Moreover, multiple examples have shown that either selective loss of only the protease activity or complete absence of these proteins can have different functional and physiological consequences. Furthermore, DUBs and UBL proteases have been shown to often contain domains or binding motifs that not only modulate their catalytic activity but can also mediate entirely different functions. This review aims to shed light on the non-catalytic, moonlighting functions of DUBs and UBL proteases, which extend beyond the hydrolysis of ubiquitin and UBL chains and are just beginning to emerge.

LRRC7
Also flagged:dermatophytosispathogenesisdipeptidylpeptidasesinfectionmetabolismextracellular
Journal Article 2024-02-22 ✓ 1 Snippet Vite-Garín T, Estrada-Cruz NA, Hernández-Castro R, Fuentes-Venado CE, Zarate-Segura PB, Frías-De-León MG, Martínez-Castillo M, Martínez-Herrera E, Pinto-Almazán R.
In-Text Gene Mentions

…The leucin aminopeptidasesLap1and Lap2 are…

Show Full Abstract

<i>Microsporum canis</i> is a widely distributed dermatophyte, which is among the main etiological agents of dermatophytosis in humans and domestic animals. This fungus invades, colonizes and nourishes itself on the keratinized tissues of the host through various virulence factors. This review will bring together the known information about the mechanisms, enzymes and their associated genes relevant to the pathogenesis processes of the fungus and will provide an overview of those virulence factors that should be better studied to establish effective methods of prevention and control of the disease. Public databases using the MeSH terms "<i>Microsporum canis</i>", "virulence factors" and each individual virulence factor were reviewed to enlist a series of articles, from where only original works in English and Spanish that included relevant information on the subject were selected. Out of the 147 articles obtained in the review, 46 were selected that reported virulence factors for <i>M. canis</i> in a period between 1988 and 2023. The rest of the articles were discarded because they did not contain information on the topic (67), some were written in different languages (3), and others were repeated in two or more databases (24) or were not original articles (7). The main virulence factors in <i>M. canis</i> are keratinases, fungilisins and subtilisins. However, less commonly reported are biofilms or dipeptidylpeptidases, among others, which have been little researched because they vary in expression or activity between strains and are not considered essential for the infection and survival of the fungus. Although it is known that they are truly involved in resistance, infection and metabolism, we recognize that their study could strengthen the knowledge of the pathogenesis of <i>M. canis</i> with the aim of achieving effective treatments, as well as the prevention and control of infection.

PTGIS
Also flagged:Endometrial polypsinfertilitygene expressioninfertileWntDKK1
Journal Article 2024-02-22 ✓ 1 Snippet Chiu CS, Yeh LY, Pan SH, Li SH.
In-Text Gene Mentions

…, LMOD1 ,PTGIS, RERG ,…

Show Full Abstract

Endometrial polyps (EPs) are benign overgrowths of the endometrial tissue lining the uterus, often causing abnormal bleeding or infertility. This study analyzed gene expression differences between EPs and adjacent endometrial tissue to elucidate intrinsic abnormalities promoting pathological overgrowth. RNA sequencing of 12 pairs of EPs and the surrounding endometrial tissue from infertile women revealed 322 differentially expressed genes. Protein-protein interaction network analysis revealed significant alterations in specific signaling pathways, notably Wnt signaling and vascular smooth muscle regulation, suggesting these pathways play critical roles in the pathophysiology of EPs. Wnt-related genes <i>DKK1</i> and <i>DKKL1</i> were upregulated, while <i>GPC3</i>, <i>GREM1</i>, <i>RSPO3</i>, <i>SFRP5</i>, and <i>WNT10B</i> were downregulated. Relevant genes for vascular smooth muscle contraction were nearly all downregulated in EPs, including <i>ACTA2</i>, <i>ACTG2</i>, <i>KCNMB1</i>, <i>KCNMB2</i>, <i>MYL9</i>, <i>PPP1R12B</i>, and <i>TAGLN</i>. Overall, the results indicate fundamental gene expression changes promote EP formation through unrestrained growth signaling and vascular defects. The intrinsic signaling abnormalities likely contribute to clinical symptoms of abnormal uterine bleeding and infertility common in EP patients. This analysis provides molecular insights into abnormal endometrial overgrowth to guide improved diagnostic and therapeutic approaches for this troublesome women's health condition. Confirmation of expanded cohorts and further investigations into implicated regulatory relationships are warranted.

Also flagged:Synthesisamidehydroxycinnamic acidsalkaloidneocryptolepinehydroxy
Journal Article 2024-02-22 No Snippets Cybulski M, Sidoryk K, Zaremba-Czogalla M, Trzaskowski B, Kubiszewski M, Tobiasz J, Jaromin A, Michalak O.
Show Full Abstract

New amide conjugates of hydroxycinnamic acids (HCAs) and the known antineoplastic 5,11-dimethyl-5<i>H</i>-indolo[2,3-<i>b</i>]quinoline (DiMIQ), an analog of the natural alkaloid neocryptolepine, were synthesized and tested in vitro for anticancer activity. The compound 9-[((2-hydroxy)cinnamoyl)amino]-5,11-dimethyl-5<i>H</i>-indolo[2,3-<i>b</i>]quinoline (<b>2</b>), which contains the ortho-coumaric acid fragment, demonstrated dose-dependent effectiveness against both normal BxPC-3 and metastatic AsPC-1 pancreatic cancer cells. The IC<sub>50</sub> values for AsPC-1 and BxPC-3 were 336.5 nM and 347.5 nM, respectively, with a selectivity index of approximately 5 for both pancreatic cancer cells compared to normal dermal fibroblasts. Conjugate <b>2</b> did not exhibit any hemolytic activity against human erythrocytes at the tested concentration. Computational studies were performed to predict the pharmacokinetic profile and potential mechanism of action of the synthesized conjugates. These studies focused on the ADME properties of the conjugates and their interactions with DNA, as well as DNA-topoisomerase alpha and beta complexes. All of the conjugates studied showed approximately one order of magnitude stronger binding to DNA compared to the reference DiMIQ, and approximately two orders of magnitude stronger binding to the topoisomerase II-DNA complex compared to DiMIQ. Conjugate <b>2</b> was predicted to have the strongest binding to the enzyme-DNA complex, with a Ki value of 2.8 nM.

Also flagged:Piceatannolepigallocatechin gallateascancerβ-lactoglobulinpalmitate
Journal Article 2024-02-22 No Snippets Meng T, Wang Z, Zhang H, Zhao Z, Huang W, Xu L, Liu M, Li J, Yan H.
Show Full Abstract

Piceatannol (PIC) and epigallocatechin gallate (EGCG) are polyphenolic compounds with applications in the treatment of various diseases such as cancer, but their stability is poor. β-lactoglobulin (β-LG) is a natural carrier that provides a protective effect to small molecule compounds and thus improves their stability. To elucidate the mechanism of action of EGCG, PIC, and palmitate (PLM) in binding to β-LG individually and jointly, this study applied molecular docking and molecular dynamics simulations combined with in-depth analyses including noncovalent interaction (NCI) and binding free energy to investigate the binding characteristics between β-LG and compounds of PIC, EGCG, and PLM. Simulations on the binary complexes of β-LG + PIC, β-LG + EGCG, and β-LG + PLM and ternary complexes of (β-LG + PLM) + PIC, (β-LG + PLM) + EGCG, β-LG + PIC) + EGCG, and (β-LG + EGCG) + PIC were performed for comparison and characterizing the interactions between binding compounds. The results demonstrated that the co-bound PIC and EGCG showed non-beneficial effects on each other. However, the centrally located PLM was revealed to be able to adjust the binding conformation of PIC, which led to the increase in binding affinity with β-LG, thus showing a synergistic effect on the co-bound PIC. The current study of β-LG co-encapsulated PLM and PIC provides a theoretical basis and research suggestions for improving the stability of polyphenols.

HFE
Also flagged:IronAtrial Fibrillationcardiovascular diseasesAFsignal transductionsupraventricular arrhythmias
Journal Article 2024-02-22 ✓ 4 Snippets Habudele Z, Chen G, Qian SE, Vaughn MG, Zhang J, Lin H.
In-Text Gene Mentions

…el morphogenesis (GO:0048514),Hfeeffect on hepcidin…

…Rs1799945 in theHFEgene and rs855791…

…ARNTL), rs1799945 (genesHFE, HFE-AS1), rs744653, rs651007…

…rs1799945 (genes HFE,HFE-AS1), rs744653, rs651007, rs8…

Show Full Abstract

Some studies suggest an association between iron overload and cardiovascular diseases (CVDs). However, the relationship between dietary iron intake and atrial fibrillation (AF) remains uncertain, as does the role of genetic loci on this association. The study involved 179,565 participants from UK Biobank, tracking incident atrial fibrillation (AF) cases. Iron intake was categorized into low, moderate, and high groups based on dietary surveys conducted from 2009 to 2012. The Cox regression model was used to estimate the risk of AF in relation to iron intake, assessing the hazard ratio (HR) and 95% confidence interval (95% CI). It also examined the impact of 165 AF-related and 20 iron-related genetic variants on this association. Pathway enrichment analyses were performed using Metascape and FUMA. During a median follow-up period of 11.6 years, 6693 (3.97%) incident AF cases were recorded. A total of 35,874 (20.0%) participants had high iron intake. High iron intake was associated with increased risk of AF [HR: 1.13 (95% CI: 1.05, 1.22)] in a fully adjusted model. Importantly, there were 83 SNPs (11 iron-related SNPs) that could enhance the observed associations. These genes are mainly involved in cardiac development and cell signal transduction pathways. High dietary iron intake increases the risk of atrial fibrillation, especially when iron intake exceeds 16.95 mg. The association was particularly significant among the 83 SNPs associated with AF and iron, the individuals with these risk genes. Gene enrichment analysis revealed that these genes are significantly involved in cardiac development and cell signal transduction processes.

Also flagged:Seedgerminationwaterseed germinationenvelopemineral
Journal Article 2024-02-22 No Snippets Rajapakshe RPVGSW, Tomlinson S, Tudor EP, Turner SR, Elliott CP, Lewandrowski W.
Show Full Abstract

Seed germination responses for most narrow-range endemic species are poorly understood, imperilling their conservation management in the face of warming and drying terrestrial ecosystems. We quantified the realized microclimatic niches and the hydrothermal germination thresholds in four threatened taxa (<i>Tetratheca erubescens, Tetratheca harperi</i>, <i>Tetratheca paynterae</i> subsp. <i>paynterae</i> and <i>Tetratheca aphylla</i> subsp. <i>aphylla</i>) that are restricted to individual Banded Ironstone Formations in Western Australia. While <i>T. aphylla</i> subsp. <i>aphylla</i> largely failed to germinate in our trials, all other species demonstrated extended hydrothermal time accumulation (186-500°C MPa days), cool minimum temperatures (7.8-8.5°C), but broad base water potential thresholds (-2.46 to -5.41 MPa) under which germination occurred. These slow germination dynamics are suggestive of cool and wet winter months, where soil moisture is retained to a greater capacity in local microsites where these species occur, rather than the warmer and drier conditions in the surrounding arid environment. Hydrothermal time-to-event modelling showed that each species occupied unique hydrothermal germination niches, which correspond with the microclimatic differences the species are exposed to. Our results provide a baseline understanding for environmental and germination thresholds that govern the recruitment, and ultimately the population structure and persistence, of these short-range endemic plants. In addition, our results can aid future conservation, as well as restoration actions such as translocation to bolster population numbers and to mitigate against losses due to anthropogenic disturbance and global environmental change.

PEBP1
Also flagged:phospholipidtumorALOX15psychological stressbreast cancerlipid
Journal Article 2024-02-22 ✓ 5 Snippets Luo X, Li DD, Li ZC, Li ZX, Zou DH, Huang F, Wang G, Wang R, Cao YF, Sun WY, Kurihara H, Liang L, Li YF, Jin W, Wu YP, He RR.
In-Text Gene Mentions

DZXY, demonstrates potent anti-breast cancer therapeutic effects by disrupting the ALOX15/PEBP1 interaction and inhibiting phospholipid peroxidation, ultimately enhancing macrophages' phagocytic capability towards tumor cells.

Mitigating phospholipid peroxidation of macrophages in stress-induced tumor microenvironment by natural ALOX15/PEBP1 complex inhibitors.

…environment by natural ALOX15/PEBP1complex inhibitors.…

…hanolamine-binding protein-1 (PEBP1), including molecular docking…

…echanism behind stress-inducedPEBP1to form a…

Show Full Abstract

<h4>Background</h4>The intricate interactions between chronic psychological stress and susceptibility to breast cancer have been recognized, yet the underlying mechanisms remain unexplored. Danzhi Xiaoyao Powder (DZXY), a traditional Chinese medicine (TCM) formula, has found clinical utility in the treatment of breast cancer. Macrophages, as the predominant immune cell population within the tumor microenvironment (TME), play a pivotal role in orchestrating tumor immunosurveillance. Emerging evidence suggests that lipid oxidation accumulation in TME macrophages, plays a critical role in breast cancer development and progression. However, a comprehensive understanding of the pharmacological mechanisms and active components of DZXY related to its clinical application in the treatment of stress-aggravated breast cancer remains elusive.<h4>Purpose</h4>This study sought to explore the plausible regulatory mechanisms and identify the key active components of DZXY contributing to its therapeutic efficacy in the context of breast cancer.<h4>Methods</h4>Initially, we conducted an investigation into the relationship between the phagocytic capacity of macrophages damaged by psychological stress and phospholipid peroxidation using flow cytometry and LC-MS/MS-based phospholipomics. Subsequently, we evaluated the therapeutic efficacy of DZXY based on the results of the tumor size, tumor weight, the phospholipid peroxidation pathway and phagocytosis of macrophage. Additionally, the target-mediated characterization strategy based on binding of arachidonate 15-lipoxygenase (ALOX15) to phosphatidylethanolamine-binding protein-1 (PEBP1), including molecular docking analysis, microscale thermophoresis (MST) assay, co-immunoprecipitation analysis and activity verification, has been further implemented to reveal the key bio-active components in DZXY. Finally, we evaluated the therapeutic efficacy of isochlorogenic acid C (ICAC) based on the results of tumor size, tumor weight, the phospholipid peroxidation pathway, and macrophage phagocytosis in vivo.<h4>Results</h4>The present study demonstrated that phospholipid peroxides, as determined by LC-MS/MS-based phospholipidomics, triggered in macrophages, which in turn compromised their capacity to eliminate tumor cells through phagocytosis. Furthermore, we elucidate the mechanism behind stress-induced PEBP1 to form a complex with ALOX15, thereby mediating membrane phospholipid peroxidation in macrophages. DZXY, demonstrates potent anti-breast cancer therapeutic effects by disrupting the ALOX15/PEBP1 interaction and inhibiting phospholipid peroxidation, ultimately enhancing macrophages' phagocytic capability towards tumor cells. Notably, ICAC emerged as a promising active component in DZXY, which can inhibit the ALOX15/PEBP1 interaction, thereby mitigating phospholipid peroxidation in macrophages.<h4>Conclusion</h4>Collectively, our findings elucidate stress increases the susceptibility of breast cancer by driving lipid peroxidation of macrophages and suggest the ALOX15/PEBP1 complex as a promising intervention target for DZXY.

Also flagged:Adenoid Cystic CarcinomaACCpathogenesisgene expressiontranscription factorsKIF11
Journal Article 2024-02-22 No Snippets Karri RL, Bojji M, Rudraraju A, Mohammad AS, Kosuru V, Kalisipudi S.
Show Full Abstract

Background Adenoid cystic carcinoma (ACC) poses clinical challenges with its unique histology and potential for perineural invasion, recurrence, and distant metastases. Recent genomic advancements have unveiled key genetic alterations in ACC, offering insights into its pathogenesis. Aim This study aims to unravel the intricate molecular landscape of ACC through a comprehensive analysis of gene expression patterns. By integrating data from multiple microarray datasets, the study explores differentially expressed genes (DEGs), their functional enrichment, protein-protein interactions (PPI), hub genes, microRNA (miRNA) involvement, transcription factors, and potential drug-gene interactions. Methods Three microarray datasets (GSE88804, GSE153002, and GSE36820) related to ACC were selected from the Gene Expression Omnibus (GEO) repository. DEGs were identified using GEO2R and further analyzed for commonalities and differences. Functional enrichment analysis, including Gene Set Enrichment Analysis (GSEA), provided insights into biological processes, cellular components, molecular functions, and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathways associated with ACC. PPI networks and hub genes were identified using the Search Tool for the Retrieval of Interacting Genes/Proteins (STRING) (STRING Consortium, Lausanne, Switzerland) database and Cytoscape (Cytoscape Consortium, California, United States). The study also explored miRNAs, transcription factors, and potential drug-gene interactions. Results The integrated analysis revealed 339 common upregulated and 643 downregulated DEGs in ACC. Functional and pathway enrichment analyses unveiled the involvement of these genes in critical cellular processes, signaling cascades, and pathways. The PPI network, comprising 904 nodes and 4139 edges, highlighted the complexity of interactions. Hub genes, including KIF11, BUB1, and DLGAP5, were identified, shedding light on their pivotal roles in cell cycle regulation. The study also identified miRNAs (e.g., hsa-mir-7-5p and hsa-mir-138-5p) and transcription factors (e.g., E2F1 and TP53) associated with ACC. Drug-gene interactions have identified potential therapeutic options, including amsacrine and rucaparib. Conclusions The ACC gene expression highlights a nuanced molecular landscape, identifying pivotal hub genes such as KIF11 and CDK1 as potential therapeutic targets for ACC, given their roles in cell cycle progression. The dysregulation of microRNAs and transcription factors adds complexity to ACC's molecular profile. Exploration of drug-gene interactions reveals promising therapeutic strategies, involving FDA-approved drugs such as amsacrine and rucaparib, providing avenues for personalized interventions.

DCC
Also flagged:Embryogenesischromatinchromosomeorganizationheterochromatineuchromatin
Journal Article 2024-02-22 ✓ 1 Snippet Jash E, Csankovszki G.
In-Text Gene Mentions

DCC

Show Full Abstract

Embryogenesis is characterized by dynamic chromatin remodeling and broad changes in chromosome architecture. These changes in chromatin organization are accompanied by transcriptional changes, which are crucial for the proper development of the embryo. Several independent mechanisms regulate this process of chromatin reorganization, including segregation of chromatin into heterochromatin and euchromatin, deposition of active and repressive histone modifications, and the formation of 3D chromatin domains such as TADs and LADs. These changes in chromatin structure are directly linked to developmental milestones such as the loss of developmental plasticity and acquisition of terminally differentiated cell identities. In this review we summarize these processes that underlie this chromatin reorganization and their impact on embryogenesis in the nematode <i>C. elegans</i>.

DCC
Also flagged:brainintellectual disabilityIDACCtype 3 posterior polymorphous corneal dystrophycognition
Journal Article 2024-02-21 ✓ 1 Snippet Heide S, Argilli E, Valence S, Boutaud L, Roux N, Mignot C, Nava C, Keren B, Giraudat K, Faudet A, Gerasimenko A, Garel C, Blondiaux E, Rastetter A, Grevent D, Le C, Mackenzie L, Richards L, Attié-Bitach T, Depienne C, Sherr E, Héron D.
In-Text Gene Mentions

DCC

Show Full Abstract

<h4>Background</h4>The neurodevelopmental prognosis of anomalies of the corpus callosum (ACC), one of the most frequent brain malformations, varies extremely, ranging from normal development to profound intellectual disability (ID). Numerous genes are known to cause syndromic ACC with ID, whereas the genetics of ACC without ID remains poorly deciphered.<h4>Methods</h4>Through a collaborative work, we describe here <i>ZEB1</i>, a gene previously involved in an ophthalmological condition called type 3 posterior polymorphous corneal dystrophy, as a new dominant gene of ACC. We report a series of nine individuals with ACC (including three fetuses terminated due to ACC) carrying a <i>ZEB1</i> heterozygous loss-of-function (LoF) variant, identified by exome sequencing.<h4>Results</h4>In five cases, the variant was inherited from a parent with a normal corpus callosum, which illustrates the incomplete penetrance of ACC in individuals with an LoF in <i>ZEB1</i>. All patients reported normal schooling and none of them had ID. Neuropsychological assessment in six patients showed either normal functioning or heterogeneous cognition. Moreover, two patients had a bicornuate uterus, three had a cardiovascular anomaly and four had macrocephaly at birth, which suggests a larger spectrum of malformations related to <i>ZEB1</i>.<h4>Conclusion</h4>This study shows <i>ZEB1</i> LoF variants cause dominantly inherited ACC without ID and extends the extraocular phenotype related to this gene.

SERPINC1
Also flagged:cancerchildhood diseasescoronary artery diseasemelanomaSkin Cutaneous Melanomacancers
Journal Article 2024-02-21 ✓ 1 Snippet Tran A, Wang A, Mickaill J, Strbenac D, Larance M, Vernon ST, Grieve SM, Figtree GA, Patrick E, Yang JYH.
In-Text Gene Mentions

…IGFALS 33 andSERPINC134 .…

Show Full Abstract

In the enduring challenge against disease, advancements in medical technology have empowered clinicians with novel diagnostic platforms. Whilst in some cases, a single test may provide a confident diagnosis, often additional tests are required. However, to strike a balance between diagnostic accuracy and cost-effectiveness, one must rigorously construct the clinical pathways. Here, we developed a framework to build multi-platform precision pathways in an automated, unbiased way, recommending the key steps a clinician would take to reach a diagnosis. We achieve this by developing a confidence score, used to simulate a clinical scenario, where at each stage, either a confident diagnosis is made, or another test is performed. Our framework provides a range of tools to interpret, visualize and compare the pathways, improving communication and enabling their evaluation on accuracy and cost, specific to different contexts. This framework will guide the development of novel diagnostic pathways for different diseases, accelerating the implementation of precision medicine into clinical practice.

HTT
Also flagged:Huntingtinneurodegenerative diseaseHDpolyglutaminecognitive declinebehavioral
Journal Article 2024-02-21 ✓ 3 Snippets Gijs M, Jorna N, Datson N, Beekman C, Dansokho C, Weiss A, Linden DEJ, Oosterloo M.
In-Text Gene Mentions

HD is caused by a CAG repeat expansion in the HTT gene, resulting in the expression of mutant huntingtin (mHTT).

…trinucleotide in theHTTgene [ 1…

…mouse and humanHTT(residues 7–13), and…

Show Full Abstract

<h4>Objective</h4>Huntington's disease (HD) is an autosomal dominant, fully penetrant, neurodegenerative disease that most commonly affects middle-aged adults. HD is caused by a CAG repeat expansion in the HTT gene, resulting in the expression of mutant huntingtin (mHTT). Our aim was to detect and quantify mHTT in tear fluid, which, to our knowledge, has never been measured before.<h4>Methods</h4>We recruited 20 manifest and 13 premanifest HD gene expansion carriers, and 20 age-matched controls. All patients underwent detailed assessments, including the Unified Huntington's Disease Rating Scale (UHDRS) total motor score (TMS) and total functional capacity (TFC) score. Tear fluid was collected using paper Schirmer's strips. The level of tear mHTT was determined using single-molecule counting SMCxPRO technology.<h4>Results</h4>The average tear mHTT levels in manifest (67,223 ± 80,360 fM) and premanifest patients (55,561 ± 45,931 fM) were significantly higher than those in controls (1,622 ± 2,179 fM). We noted significant correlations between tear mHTT levels and CAG repeat length, "estimated years to diagnosis," disease burden score and UHDRS TMS and TFC. The receiver operating curve demonstrated an almost perfect score (area under the curve [AUC] = 0.9975) when comparing controls to manifest patients. Similarly, the AUC between controls and premanifest patients was 0.9846. The optimal cutoff value for distinguishing between controls and manifest patients was 4,544 fM, whereas it was 6,596 fM for distinguishing between controls and premanifest patients.<h4>Conclusion</h4>Tear mHTT has potential for early and noninvasive detection of alterations in HD patients and could be integrated into both clinical trials and clinical diagnostics.

Also flagged:tumorscancertumorcell growthdeathchromatin
Journal Article 2024-02-21 No Snippets Xiang K, Wang E, Mantyh J, Rupprecht G, Negrete M, Sanati G, Hsu C, Randon P, Dohlman A, Kretzschmar K, Bose S, Giroux N, Ding S, Wang L, Balcazar JP, Huang Q, Sundaramoorthy P, Xi R, McCall SJ, Wang Z, Jiang C, Kang Y, Kopetz S, Crawford GE, Lipkin SM, Wang XF, Clevers H, Hsu D, Shen X.
Show Full Abstract

Patient-Derived Organoids (PDO) and Xenografts (PDX) are the current gold standards for patient-derived models of cancer (PDMC). Nevertheless, how patient tumor cells evolve in these models and the impact on drug response remains unclear. Herein, the transcriptomic and chromatin accessibility landscapes of matched colorectal cancer (CRC) PDO, PDX, PDO-derived PDX (PDOX), and original patient tumors (PT) are compared. Two major remodeling axes are discovered. The first axis delineates PDMC from PT, and the second axis distinguishes PDX and PDO. PDOX are more similar to PDX than PDO, indicating the growth environment is a driving force for chromatin adaptation. Transcription factors (TF) that differentially bind to open chromatins between matched PDO and PDOX are identified. Among them, KLF14 and EGR2 footprints are enriched in PDOX relative to matched PDO, and silencing of KLF14 or EGR2 promoted tumor growth. Furthermore, EPHA4, a shared downstream target gene of KLF14 and EGR2, altered tumor sensitivity to MEK inhibitor treatment. Altogether, patient-derived CRC cells undergo both common and distinct chromatin remodeling in PDO and PDX/PDOX, driven largely by their respective microenvironments, which results in differences in growth and drug sensitivity and needs to be taken into consideration when interpreting their ability to predict clinical outcome.

Also flagged:Lung MetastasisPolyglycerolBreast cancermetastatic diseaseprimary tumorpaclitaxel
Journal Article 2024-02-21 No Snippets Sabatelle RC, Chu NQ, Blessing W, Kharroubi H, Bressler E, Tsai L, Shih A, Grinstaff MW, Colson Y.
Show Full Abstract

Breast cancer is among the most prevalent malignancies, accounting for 685,000 deaths worldwide in 2020, largely due to its high metastatic potential. Depending on the stage and tumor characteristics, treatment involves surgery, chemotherapy, targeted biologics, and/or radiation therapy. However, current treatments are insufficient for treating or preventing metastatic disease. Herein, we describe supratherapeutic paclitaxel-loaded nanoparticles (81 wt % paclitaxel) to treat the primary tumor and reduce the risk of subsequent metastatic lesions in the lungs. Primary tumor volume and lung metastasis are reduced by day 30, compared to the paclitaxel clinical standard treatment. The ultrahigh levels of paclitaxel afford an immunotherapeutic effect, increasing natural killer cell activation and decreasing NETosis in the lung, which limits the formation of metastatic lesions.

Also flagged:cancerChemotherapy-induced peripheral neuropathyCIPNperipheral neuropathysensory neuropathyvinca alkaloids
Journal Article 2024-02-21 No Snippets Smulders PSH, Heikamp K, Hermanides J, Hollmann MW, Ten Hoope W, Weber NC.
Show Full Abstract

<h4>Abstract</h4>Developments in human cellular reprogramming now allow for the generation of human neurons for in vitro disease modelling. This technique has since been used for chemotherapy-induced peripheral neuropathy (CIPN) research, resulting in the description of numerous CIPN models constructed from human neurons. This systematic review provides a critical analysis of available models and their methodological considerations (ie, used cell type and source, CIPN induction strategy, and validation method) for prospective researchers aiming to incorporate human in vitro models of CIPN in their research. The search strategy was developed with assistance from a clinical librarian and conducted in MEDLINE (PubMed) and Embase (Ovid) on September 26, 2023. Twenty-six peer-reviewed experimental studies presenting original data about human reprogrammed nonmotor neuron cell culture systems and relevant market available chemotherapeutics drugs were included. Virtually, all recent reports modeled CIPN using nociceptive dorsal root ganglion neurons. Drugs known to cause the highest incidence of CIPN were most used. Furthermore, treatment effects were almost exclusively validated by the acute effects of chemotherapeutics on neurite dynamics and cytotoxicity parameters, enabling the extrapolation of the half-maximal inhibitory concentration for the 4 most used chemotherapeutics. Overall, substantial heterogeneity was observed in the way studies applied chemotherapy and reported their findings. We therefore propose 6 suggestions to improve the clinical relevance and appropriateness of human cellular reprogramming-derived CIPN models.

HTT
Also flagged:Nuclear porecytoplasmnucleocytoplasmicneurodegenerative diseasecytoplasmicinflammatory response
Journal Article 2024-02-21 ✓ 3 Snippets Fare CM, Rothstein JD.
In-Text Gene Mentions

Interestingly, Htt was recently identified to have a proline-tyrosine nuclear localization signal (PY-NLS) that is recognized by the nuclear import receptors, Karyopherin β1/β2 (Kapβ1/2) [128].

Translation of these CAG repeats produces huntingtin protein (Htt) containing a poly-glutamine (polyQ) tract that can be dozens of residues long [21–23,125].

To date, investigations into how NCT is affected in HD have centered on the Htt protein.

Show Full Abstract

The separation of genetic material from bulk cytoplasm has enabled the evolution of increasingly complex organisms, allowing for the development of sophisticated forms of life. However, this complexity has created new categories of dysfunction, including those related to the movement of material between cellular compartments. In eukaryotic cells, nucleocytoplasmic trafficking is a fundamental biological process, and cumulative disruptions to nuclear integrity and nucleocytoplasmic transport are detrimental to cell survival. This is particularly true in post-mitotic neurons, where nuclear pore injury and errors to nucleocytoplasmic trafficking are strongly associated with neurodegenerative disease. In this review, we summarize the current understanding of nuclear pore biology in physiological and pathological contexts and discuss potential therapeutic approaches for addressing nuclear pore injury and dysfunctional nucleocytoplasmic transport.

SOX6
Also flagged:anaplastic ependymomaH3K27Mdiffuse midline gliomabrain tumorstumorscancer
Journal Article 2024-02-21 ✓ 1 Snippet Zang D, Dong Z, Liu Y, Chen Q.
In-Text Gene Mentions

…cluster, OLIG1+, OLIG2+,SOX6+ cluster, MAG+,…

Show Full Abstract

<h4>Background</h4>Anaplastic ependymoma and H3K27M-mutant diffuse midline glioma are two common subtypes of brain tumors with poor long-term prognosis. The present study analyzed and compared the differences in cell types between two tumors by single-cell RNA sequencing (scRNA-seq) technology.<h4>Methods</h4>ScRNA-seq was performed to profile cells from cancer tissue from anaplastic ependymoma patient and H3K27M-mutant diffuse midline glioma patient. Cell clustering, marker gene identification, cell type annotation, copy number variation analysis and function analysis of differentially expressed genes were then performed.<h4>Results</h4>A total of 11,219 cells were obtained from anaplastic ependymoma and H3K27M mutant diffuse midline glioma, and these cells categorized into 12 distinct clusters. Each cell cluster could be characterized with specific cell markers to indicate cellular heterogeneity. Five cell types were annotated in each sample, including astrocyte, oligodendrocytes, microglial cell, neural progenitor cell and immune cell. The cluster types and proportion of cell types were not consistent between the two brain tumors. Functional analyses suggest that these cell clusters are involved in tumor-associated pathways, with slight differences in the cells of origin between the two tumors. In addition, cell communication analysis showed that the NRG3-ERBB4 pair is a key Ligand-receptor pair for anaplastic ependymoma, while in H3K27M-mutant diffuse midline glioma it is the PTN-PTPRZ1 pair that establishes contact with other cells.<h4>Conclusion</h4>There was intratumor heterogeneity in anaplastic ependymoma and H3K27M mutant diffuse midline glioma, and that the subtype differences may be due to differences in the origin of the cells.

DCC
Also flagged:prostate tumortumorandrogen receptorARandrogenprostate cancer
Journal Article 2024-02-21 ✓ 5 Snippets van Genderen MNG, Kneppers J, Zaalberg A, Bekers EM, Bergman AM, Zwart W, Eduati F.
In-Text Gene Mentions

…cultured in 5%DCCand 1% PS…

…in RPMI-1640, 5%DCC+ 1% PS.…

…only optimized forDCC+ R1881 conditions,…

…in hormone deficient (DCC+ DMSO) versus…

…versus hormone proficient (DCC+ R1881) conditions…

Show Full Abstract

Inhibiting androgen receptor (AR) signaling through androgen deprivation therapy (ADT) reduces prostate cancer (PCa) growth in virtually all patients, but response may be temporary, in which case resistance develops, ultimately leading to lethal castration-resistant prostate cancer (CRPC). The tumor microenvironment (TME) plays an important role in the development and progression of PCa. In addition to tumor cells, TME-resident macrophages and fibroblasts express AR and are therefore also affected by ADT. However, the interplay of different TME cell types in the development of CRPC remains largely unexplored. To understand the complex stochastic nature of cell-cell interactions, we created a PCa-specific agent-based model (PCABM) based on in vitro cell proliferation data. PCa cells, fibroblasts, "pro-inflammatory" M1-like and "pro-tumor" M2-like polarized macrophages are modeled as agents from a simple set of validated base assumptions. PCABM allows us to simulate the effect of ADT on the interplay between various prostate TME cell types. The resulting in vitro growth patterns mimic human PCa. Our PCABM can effectively model hormonal perturbations by ADT, in which PCABM suggests that CRPC arises in clusters of resistant cells, as is observed in multifocal PCa. In addition, fibroblasts compete for cellular space in the TME while simultaneously creating niches for tumor cells to proliferate in. Finally, PCABM predicts that ADT has immunomodulatory effects on macrophages that may enhance tumor survival. Taken together, these results suggest that AR plays a critical role in the cellular interplay and stochastic interactions in the TME that influence tumor cell behavior and CRPC development.

STAU1
Also flagged:MALAT1NEAT1MEG3Uchl1RNA polymerase IIIbinding
Journal Article 2024-02-21 ✓ 1 Snippet Sharma H, Valentine MNZ, Toki N, Sueki HN, Gustincich S, Takahashi H, Carninci P.
In-Text Gene Mentions

…lncRNAs 23 ,STAU1-mediated mRNA decay 24…

Show Full Abstract

RNA structure folding largely influences RNA regulation by providing flexibility and functional diversity. In silico and in vitro analyses are limited in their ability to capture the intricate relationships between dynamic RNA structure and RNA functional diversity present in the cell. Here, we investigate sequence, structure and functional features of mouse and human SINE-transcribed retrotransposons embedded in SINEUPs long non-coding RNAs, which positively regulate target gene expression post-transcriptionally. In-cell secondary structure probing reveals that functional SINEs-derived RNAs contain conserved short structure motifs essential for SINEUP-induced translation enhancement. We show that SINE RNA structure dynamically changes between the nucleus and cytoplasm and is associated with compartment-specific binding to RBP and related functions. Moreover, RNA-RNA interaction analysis shows that the SINE-derived RNAs interact directly with ribosomal RNAs, suggesting a mechanism of translation regulation. We further predict the architecture of 18 SINE RNAs in three dimensions guided by experimental secondary structure data. Overall, we demonstrate that the conservation of short key features involved in interactions with RBPs and ribosomal RNA drives the convergent function of evolutionarily distant SINE-transcribed RNAs.

OLFM4
Also flagged:cDNAHprtGapdhLgr5Lgr5-GFP16S rRNA
Journal Article 2024-02-21 ✓ 5 Snippets Gaudino SJ, Singh A, Huang H, Padiadpu J, Jean-Pierre M, Kempen C, Bahadur T, Shiomitsu K, Blumberg R, Shroyer KR, Beyaz S, Shulzhenko N, Morgun A, Kumar P.
In-Text Gene Mentions

…RT-PCR analysis revealed no difference in Lgr5 orOlfm4transcripts after stimulation with pure media, IL-22, PA, or PA + rIL-22 (Supplementary Fig. 8C ).…

…Dako; Ref: F0372),OLFM4(1:200; Cell Signaling…

…in Lgr5 orOlfm4transcripts after stimulation…

…( Lgr5 ,Olfm4, Sox9 )…

…;Villin-cre mice forOLFM4(Supplementary Fig. 8F…

Show Full Abstract

IL-22 is critical for ameliorating obesity-induced metabolic disorders. However, it is unknown where IL-22 acts to mediate these outcomes. Here we examine the importance of tissue-specific IL-22RA1 signaling in mediating long-term high fat diet (HFD) driven metabolic disorders. To do so, we generated intestinal epithelium-, liver-, and white adipose tissue (WAT)-specific Il22ra1 knockout and littermate control mice. Intestinal epithelium- and liver-specific IL-22RA1 signaling upregulated systemic glucose metabolism. Intestinal IL-22RA1 signaling also mediated liver and WAT metabolism in a microbiota-dependent manner. We identified an association between Oscillibacter and elevated WAT inflammation, likely induced by Mmp12 expressing macrophages. Mechanistically, transcription of intestinal lipid metabolism genes is regulated by IL-22 and potentially IL-22-induced IL-18. Lastly, we show that Paneth cell-specific IL-22RA1 signaling, in part, mediates systemic glucose metabolism after HFD. Overall, these results elucidate a key role of intestinal epithelium-specific IL-22RA1 signaling in regulating intestinal metabolism and alleviating systemic obesity-associated disorders.

HTT
Also flagged:nucleotidemismatch repairHuntington diseaseHDLynch syndromeLS
Journal Article 2024-02-21 ✓ 4 Snippets Dalene Skarping K, Arning L, Petersén Å, Nguyen HP, Gebre-Medhin S.
In-Text Gene Mentions

In HD, the underlying pathogenic CAG repeat is located in exon 1 in the huntingtin gene (HTT)2.

Here we have studied constitutional HTT CAG repeat size in two cohorts of individuals with Lynch syndrome (LS) carrying heterozygous loss-of-function variants in the MMR genes MLH1 (n = 12/60; Lund cohort/Bochum cohort, respectively), MSH2 (n = 15/88), MSH6 (n = 21/23), and controls (n = 19/559).

…huntingtin gene (HTT).…

…huntingtin gene (HTT) 2 .…

Show Full Abstract

DNA mismatch repair (MMR) is thought to contribute to the onset and progression of Huntington disease (HD) by promoting somatic expansion of the pathogenic CAG nucleotide repeat in the huntingtin gene (HTT). Here we have studied constitutional HTT CAG repeat size in two cohorts of individuals with Lynch syndrome (LS) carrying heterozygous loss-of-function variants in the MMR genes MLH1 (n = 12/60; Lund cohort/Bochum cohort, respectively), MSH2 (n = 15/88), MSH6 (n = 21/23), and controls (n = 19/559). The sum of CAG repeats for both HTT alleles in each individual was calculated due to unknown segregation with the LS allele. In the larger Bochum cohort, the sum of CAG repeats was lower in the MLH1 subgroup compared to controls (MLH1 35.40 CAG repeats ± 3.6 vs. controls 36.89 CAG repeats ± 4.5; p = 0.014). All LS genetic subgroups in the Bochum cohort displayed lower frequencies of unstable HTT intermediate alleles and lower HTT somatic CAG repeat expansion index values compared to controls. Collectively, our results indicate that MMR gene haploinsufficiency could have a restraining impact on constitutional HTT CAG repeat size and support the notion that the MMR pathway is a driver of nucleotide repeat expansion diseases.

Also flagged:excitonphosphorescencehalogenpolymersmetalsRTP
Journal Article 2024-02-21 No Snippets Huang R, He Y, Wang J, Zou J, Wang H, Sun H, Xiao Y, Zheng D, Ma J, Yu T, Huang W.
Show Full Abstract

Self-monitoring materials have promising applications in structural health monitoring. However, developing organic afterglow materials for self-monitoring is a highly intriguing yet challenging task. Herein, we design two organic molecules with a twisted donor-acceptor-acceptor' configuration and achieve dual-emissive afterglow with tunable lifetimes (86.1-287.7 ms) by doping into various matrices. Based on a photosensitive resin, a series of complex structures are prepared using 3D printing technology. They exhibit tunable afterglow lifetime and Young's Modulus by manipulating the photocuring time and humidity level. With sufficient photocuring or in dry conditions, a long-lived bright green afterglow without apparent deformation under external loading is realized. We demonstrate that the mechanical properties of complex 3D printing structures can be well monitored by controlling the photocuring time and humidity, and quantitively manifested by afterglow lifetimes. This work casts opportunities for constructing flexible 3D printing devices that can achieve sensing and real-time mechanical detection.

HFE
Also flagged:hepatocellular carcinomaNAFLDtumortumorscanceralpha-fetoprotein
Journal Article 2024-02-21 ✓ 1 Snippet Beudeker BJB, Guha R, Stoyanova K, IJzermans JNM, de Man RA, Sprengers D, Boonstra A.
In-Text Gene Mentions

…as HCC (3%),hemochromatosis(2%), porphyria (2%),…

Show Full Abstract

The incidence of hepatocellular carcinoma (HCC) in non-cirrhotic livers is rising significantly, but clear risk factors for screening remain elusive. This study sought to characterize non-cirrhotic HCC etiologies. HCC cases from 2009 to 2020 in a Dutch referral center were examined, revealing 371 out of 1654 cases (22%) as non-cirrhotic. Notably, the incidence of non-cirrhotic HCC increased by 61% in the time frame between 2009 and 2020. Interestingly 39% of non-cirrhotic HCC cases had cryptogenic origins. Cryptogenic non-cirrhotic HCC exhibited similarities with non-cirrhotic NAFLD HCC, but displayed advanced tumor stages, lower surgical rates, and a more frequent presence of symptoms, which substantiated in poor survival rates. Advanced cryptogenic non-cirrhotic HCC stages exhibited elevated serum interleukin-6 levels compared to non-cirrhotic HCC with defined etiologies. Comparative analysis encompassing cryptogenic and NAFLD non-cirrhotic HCC cohorts and controls unveiled comparable circulating immune biomarker profiles and PNPLA3 polymorphisms. To conclude, the primary etiology of non-cirrhotic HCC in our cohort has not defined risk factors. This cryptogenic variant exhibits distinct traits, such as advanced tumors and increased symptoms, and most resemble burned-out NAFLD. Understanding this HCC variant is crucial for improving screening and management strategies.

Also flagged:hydrogenperoxideextracellulardiffuse large B-cell lymphomaDLBCLtumour
Journal Article 2024-02-21 No Snippets Witmond M, Keizer E, Kiffen B, Huck WTS, van Buggenum JAGL.
Show Full Abstract

Although in vivo extracellular microenvironments are dynamic, most in vitro studies are conducted under static conditions. Here, we exposed diffuse large B-cell lymphoma (DLBCL) cells to gradient increases in the concentration of hydrogen peroxide (H<sub>2</sub>O<sub>2</sub>), thereby capturing some of the dynamics of the tumour microenvironment. Subsequently, we measured the phosphorylation response of B-cell receptor (BCR) signalling proteins CD79a, SYK and PLCγ2 at a high temporal resolution via single-cell phospho-specific flow cytometry. We demonstrated that the cells respond bimodally to static extracellular H<sub>2</sub>O<sub>2</sub>, where the percentage of cells that respond is mainly determined by the concentration. Computational analysis revealed that the bimodality results from a combination of a steep dose-response relationship and cell-to-cell variability in the response threshold. Dynamic gradient inputs of varying durations indicated that the H<sub>2</sub>O<sub>2</sub> concentration is not the only determinant of the signalling response, as cells exposed to more shallow gradients respond at lower H<sub>2</sub>O<sub>2</sub> levels. A minimal model of the proximal BCR network qualitatively reproduced the experimental findings and uncovered a rate-dependent sensitivity to H<sub>2</sub>O<sub>2</sub>, where a lower rate of increase correlates to a higher sensitivity. These findings will bring us closer to understanding how cells process information from their complex and dynamic in vivo environments.

SOX6
Also flagged:MAP4K4SOXcervical cancercell cycletransforming growth factor beta 2TGFB2
Journal Article 2024-02-21 ✓ 5 Snippets Zheng H, Liu M, Shi S, Huang H, Yang X, Luo Z, Song Y, Xu Q, Li T, Xue L, Lu F, Wang J.
In-Text Gene Mentions

ABT‐263 (navitoclax) and ABT‐199 (venetoclax), two classic senolytics, can specifically eliminate the SOX6‐induced senescent cervical cancer cells, and thus significantly improve the chemosensitivity of cisplatin‐resistant cervical cancer cells.

Therefore, the MAP4K4/WT1–ATF2–TGFβ2 pathways contribute to the SOX6‐induced senescence of CC cells.

For the effect of ABT‐263 in improving the sensitivity of SOX6‐induced senescent CC cells to cisplatin treatment, HeLa‐HA‐SOX6‐tet cells (5 × 106 cells/mouse) were subcutaneously injected into the left flank of 15 six‐week‐old female BALB/c nude mice (CAnN.Cg‐Foxn1nu/Crl) (Beijing Vital River Laboratory Animal Technology Co., Ltd.).

The percentage of Ki‐67 positive cells in the tumors formed by the Dox‐treated HeLa‐HA‐SOX6‐tet cells was significantly lower than that in the tumors formed by the solvent control‐treated HeLa‐HA‐SOX6‐tet cells, and the percentage of senescent cells in the tumors formed by the Dox‐treated HeLa‐HA‐SOX6‐tet cells was significantly higher than that in the tumors formed by the solvent control‐treated HeLa‐HA‐SOX6‐tet cells, but there were no significant differences between the tumors formed by HeLa‐HA‐SOX6ΔHMG‐tet cells with and without Dox treatment (Fig. 2E,F).

Since we previously found that SOX6 could promote the autophagy of CC cells through the MAP4K4–ERK/AKT–mTOR pathway [17], and autophagy is one of the initial steps of some senescent cells, the effects of SOX6 in autophagy and senescence of CC cells were dynamically monitored.

Show Full Abstract

SRY-box transcription factor 6 (SOX6) is a member of the SOX gene family and inhibits the proliferation of cervical cancer cells by inducing cell cycle arrest. However, the final cell fate and significance of these cell-cycle-arrested cervical cancer cells induced by SOX6 remains unclear. Here, we report that SOX6 inhibits the proliferation of cervical cancer cells by inducing cellular senescence, which is mainly mediated by promoting transforming growth factor beta 2 (TGFB2) gene expression and subsequently activating the TGFβ2-Smad2/3-p53-p21<sup>WAF1/CIP1</sup>-Rb pathway. SOX6 promotes TGFB2 gene expression through the MAP4K4-MAPK (JNK/ERK/p38)-ATF2 and WT1-ATF2 pathways, which is dependent on its high-mobility group (HMG) domain. In addition, the SOX6-induced senescent cervical cancer cells are resistant to cisplatin treatment. ABT-263 (navitoclax) and ABT-199 (venetoclax), two classic senolytics, can specifically eliminate the SOX6-induced senescent cervical cancer cells, and thus significantly improve the chemosensitivity of cisplatin-resistant cervical cancer cells. This study uncovers that the MAP4K4/WT1-ATF2-TGFβ2 axis mediates SOX6-induced cellular senescence, which is a promising therapeutic target in improving the chemosensitivity of cervical cancer.

HFE
Also flagged:ADAgingdementiaosteoporosischolesterolapolipoprotein E
Journal Article 2024-02-21 ✓ 3 Snippets Tang AS, Rankin KP, Cerono G, Miramontes S, Mills H, Roger J, Zeng B, Nelson C, Soman K, Woldemariam S, Li Y, Lee A, Bove R, Glymour M, Aghaeepour N, Oskotsky TT, Miller Z, Allen IE, Sanders SJ, Baranzini S, Sirota M.
In-Text Gene Mentions

Osteoporosis-specific SPOKE network prioritized shared gene associations with IL6, SMAD3, TNF, HSPG2, GATA1, GFPT1, HFE, INS and ALB (Fig. 5b).

…, GFPT1 ,HFE, INS and…

…include APOE ,HFEand HSPG2 variants…

Show Full Abstract

Identification of Alzheimer's disease (AD) onset risk can facilitate interventions before irreversible disease progression. We demonstrate that electronic health records from the University of California, San Francisco, followed by knowledge networks (for example, SPOKE) allow for (1) prediction of AD onset and (2) prioritization of biological hypotheses, and (3) contextualization of sex dimorphism. We trained random forest models and predicted AD onset on a cohort of 749 individuals with AD and 250,545 controls with a mean area under the receiver operating characteristic of 0.72 (7 years prior) to 0.81 (1 day prior). We further harnessed matched cohort models to identify conditions with predictive power before AD onset. Knowledge networks highlight shared genes between multiple top predictors and AD (for example, APOE, ACTB, IL6 and INS). Genetic colocalization analysis supports AD association with hyperlipidemia at the APOE locus, as well as a stronger female AD association with osteoporosis at a locus near MS4A6A. We therefore show how clinical data can be utilized for early AD prediction and identification of personalized biological hypotheses.

CACNA1E
Also flagged:Epilepsygenetic disordercalciummetabolismtranscription factorepilepsy-type disorders
Journal Article 2024-02-21 ✓ 1 Snippet Najafi P, Reimer C, Gilthorpe JD, Jacobsen KR, Ramløse M, Paul NF, Simianer H, Tetens J, Falker-Gieske C.
In-Text Gene Mentions

…genes ADORA2B ,CACNA1E, CAMK1D ,…

Show Full Abstract

Epilepsy is a complex genetic disorder that affects about 2% of the global population. Although the frequency and severity of epileptic seizures can be reduced by a range of pharmacological interventions, there are no disease-modifying treatments for epilepsy. The development of new and more effective drugs is hindered by a lack of suitable animal models. Available rodent models may not recapitulate all key aspects of the disease. Spontaneous epileptic convulsions were observed in few Göttingen Minipigs (GMPs), which may provide a valuable alternative animal model for the characterisation of epilepsy-type diseases and for testing new treatments. We have characterised affected GMPs at the genome level and have taken advantage of primary fibroblast cultures to validate the functional impact of fixed genetic variants on the transcriptome level. We found numerous genes connected to calcium metabolism that have not been associated with epilepsy before, such as ADORA2B, CAMK1D, ITPKB, MCOLN2, MYLK, NFATC3, PDGFD, and PHKB. Our results have identified two transcription factor genes, EGR3 and HOXB6, as potential key regulators of CACNA1H, which was previously linked to epilepsy-type disorders in humans. Our findings provide the first set of conclusive results to support the use of affected subsets of GMPs as an alternative and more reliable model system to study human epilepsy. Further neurological and pharmacological validation of the suitability of GMPs as an epilepsy model is therefore warranted.

Also flagged:secretionsecretions-19SynthesisCOVID-19infection
Journal Article 2024-02-21 No Snippets Calvet GA, Kara E, Gonsalves L, Seuc AH, de Oliveira RVC, Thwin SS, Gomez Ponce de León R, Gámez MC, Peña GM, Pendás BVR, Alzugaray MG, Carballo GO, Cala DC, Guimarães PMQ, Bonet M, Taylor M, Thorson A, Kim C, Ali M, Broutet N.
Show Full Abstract

<h4>Objective</h4>To identify and summarise the evidence on the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) RNA detection and persistence in body fluids associated with sexual activity (saliva, semen, vaginal secretion, urine and faeces/rectal secretion).<h4>Eligibility</h4>All studies that reported detection of SARS-CoV-2 in saliva, semen, vaginal secretion, urine and faeces/rectal swabs.<h4>Information sources</h4>The WHO COVID-19 database from inception to 20 April 2022.<h4>Risk of bias assessment</h4>The National Institutes of Health tools.<h4>Synthesis of results</h4>The proportion of patients with positive results for SARS-CoV-2 and the proportion of patients with a viral duration/persistence of at least 14 days in each fluid was calculated using fixed or random effects models.<h4>Included studies</h4>A total of 182 studies with 10 023 participants.<h4>Results</h4>The combined proportion of individuals with detection of SARS-CoV-2 was 82.6% (95% CI: 68.8% to 91.0%) in saliva, 1.6% (95% CI: 0.9% to 2.6%) in semen, 2.7% (95% CI: 1.8% to 4.0%) in vaginal secretion, 3.8% (95% CI: 1.9% to 7.6%) in urine and 31.8% (95% CI: 26.4% to 37.7%) in faeces/rectal swabs. The maximum viral persistence for faeces/rectal secretions was 210 days, followed by semen 121 days, saliva 112 days, urine 77 days and vaginal secretions 13 days. Culturable SARS-CoV-2 was positive for saliva and faeces.<h4>Limitations</h4>Scarcity of longitudinal studies with follow-up until negative results.<h4>Interpretation</h4>SARS-CoV-2 RNA was detected in all fluids associated with sexual activity but was rare in semen and vaginal secretions. Ongoing droplet precautions and awareness of the potential risk of contact with faecal matter/rectal mucosa are needed.<h4>Prospero registration number</h4>CRD42020204741.

SOX6
Also flagged:MX1UBE2L6atherosclerosismetabolismcholesterollipid
Journal Article 2024-02-21 ✓ 1 Snippet Wang G, Hua R, Chen X, He X, Dingming Y, Chen H, Zhang B, Dong Y, Liu M, Liu J, Liu T, Zhao J, Zhao YQ, Qiao L.
In-Text Gene Mentions

…2018 ), aSOX6gene polymorphism (rs16933090)…

Show Full Abstract

<h4>Background</h4>The coexistence of diabetes mellitus (DM) and atherosclerosis (AS) is widespread, although the explicit metabolism and metabolism-associated molecular patterns (MAMPs) responsible for the correlation are still unclear.<h4>Methods</h4>Twenty-four genetically wild-type male Ba-Ma mini pigs were randomly divided into five groups distinguished by different combinations of 90 mg/kg streptozotocin (STZ) intravenous injection and high-cholesterol/lipid (HC) or high-lipid (HL) diet feeding for 9 months in total. Pigs in the STZ+HC and STZ+HL groups were injected with STZ first and then fed the HC or HL diet for 9 months. In contrast, pigs in the HC+STZ and HL+STZ groups were fed the HC or HL diet for 9 months and injected with STZ at 3 months. The controls were only fed a regular diet for 9 months. The blood glucose and abdominal aortic plaque observed through oil red O staining were used as evaluation indicators for successful modelling of DM and AS. A microarray gene expression analysis of all subjects was performed.<h4>Results</h4>Atherosclerotic lesions were observed only in the HC+STZ and STZ+HC groups. A total of 103 differentially expressed genes (DEGs) were identified as common between them. The most significantly enriched pathways of 103 common DEGs were influenza A, hepatitis C, and measles. The global and internal protein-protein interaction (PPI) networks of the 103 common DEGs consisted of 648 and 14 nodes, respectively. The top 10 hub proteins, namely, ISG15, IRG6, IRF7, IFIT3, MX1, UBE2L6, DDX58, IFIT2, USP18, and IFI44L, drive aspects of DM and AS. MX1 and UBE2L6 were the intersection of internal and global PPI networks. The expression of MX1 and UBE2L6 was 507.22 ± 342.56 and 96.99 ± 49.92 in the HC+STZ group, respectively, which was significantly higher than others and may be linked to the severity of hyperglycaemia-related atherosclerosis. Further PPI network analysis of calcium/micronutrients, including MX1 and UBE2L6, consisted of 58 and 18 nodes, respectively. The most significantly enriched KEGG pathways were glutathione metabolism, pyrimidine metabolism, purine metabolism, and metabolic pathways.<h4>Conclusions</h4>The global and internal PPI network of the 103 common DEGs consisted of 648 and 14 nodes, respectively. The intersection of the nodes of internal and global PPI networks was MX1 and UBE2L6, suggesting their key role in the comorbidity mechanism of DM and AS. This inference was partly verified by the overexpression of MX1 and UBE2L6 in the HC+STZ group but not others. Further calcium- and micronutrient-related enriched KEGG pathway analysis supported that MX1 and UBE2L6 may affect the inflammatory response through micronutrient metabolic pathways, conceptually named metaflammation. Collectively, MX1 and UBE2L6 may be potential common biomarkers for DM and AS that may reveal metaflammatory aspects of the pathological process, although proper validation is still needed to determine their contribution to the detailed mechanism.

Also flagged:esterselectron transferLewis acidssynthesiscarboxylic acidsBarton esters
Journal Article 2024-02-21 No Snippets Azpilcueta-Nicolas CR, Lumb JP.
Show Full Abstract

Due to their ease of preparation, stability, and diverse reactivity, <i>N</i>-hydroxyphthalimide (NHPI) esters have found many applications as radical precursors. Mechanistically, NHPI esters undergo a reductive decarboxylative fragmentation to provide a substrate radical capable of engaging in diverse transformations. Their reduction via single-electron transfer (SET) can occur under thermal, photochemical, or electrochemical conditions and can be influenced by a number of factors, including the nature of the electron donor, the use of Brønsted and Lewis acids, and the possibility of forming charge-transfer complexes. Such versatility creates many opportunities to influence the reaction conditions, providing a number of parameters with which to control reactivity. In this perspective, we provide an overview of the different mechanisms for radical reactions involving NHPI esters, with an emphasis on recent applications in radical additions, cyclizations and decarboxylative cross-coupling reactions. Within these reaction classes, we discuss the utility of the NHPI esters, with an eye towards their continued development in complexity-generating transformations.

HTT
Also flagged:disorders of the brainbradyphreniaHDbradykinesiaschizophreniaencephalitis lethargica
Journal Article 2024-02-21 ✓ 2 Snippets Parkin GM, Culbert B, Churchill E, Gilbert PE, Corey-Bloom J.
In-Text Gene Mentions

Huntington’s Disease is a neurodegenerative disorder caused by a hereditary, autosomal dominant mutation in the Huntingtin (HTT) gene.

…in the Huntingtin (HTT) gene .…

Show Full Abstract

<h4>Background</h4>Bradyphrenia, best thought of as the mental equivalent of bradykinesia, has been described in several disorders of the brain including Parkinson's disease and schizophrenia; however, little is known about this phenomenon in Huntington's Disease (HD).<h4>Objective</h4>The aim of this study was to investigate the presence of bradyphrenia in HD using the Computerized Test of Information Processing (CTiP), an easy to administer and objective task that assesses cognitive processing speed with increasing task complexity.<h4>Methods</h4>This study included 211 participants: Huntington's Disease Integrated Staging System (HD-ISS) Stage 0 [n = 28], Stage 1 [n = 30], Stage 2 [n = 48] and Stage 3 [n = 48], and healthy controls (HC) [n = 57]. The CTiP incorporates three subtests: Simple Reaction Time (SRT), which assesses baseline motor function; Choice Reaction Time (CRT), with an added decisional component; and Semantic Search Reaction Time (SSRT), with an added conceptual component. SRT scores were subtracted from CRT and SSRT scores to establish a motor-corrected measure of central conduction time, which was used to operationalize bradyphrenia.<h4>Results</h4>HD-ISS and HC within-group reaction times differed significantly when comparing motor-corrected CRT vs SSRT (all <i>p</i>s < 0.0001). Furthermore, the magnitude of these differences increased with HD disease stage (p < 0.0001). An ROC analysis determined that motor-corrected within-subject differences significantly distinguished Stage 2 + 3 from Stage 0 + 1 (AUC = 0.72, p < 0.0001).<h4>Conclusions</h4>We report evidence of bradyphrenia in HD that increases with disease progression. This processing deficit, which can be quantified using the CTiP, has the potential to greatly impact HD daily life and warrants additional research.

Also flagged:ischemic strokeshort-chain fatty acidstrimethylamineoxidelipopolysaccharidesinflammatory responses
Journal Article 2024-02-21 No Snippets Hediyal TA, Vichitra C, Anand N, Bhaskaran M, Essa SM, Kumar P, Qoronfleh MW, Akbar M, Kaul-Ghanekar R, Mahalakshmi AM, Yang J, Song BJ, Monaghan TM, Sakharkar MK, Chidambaram SB.
Show Full Abstract

The bidirectional communication between the gut and brain or gut-brain axis is regulated by several gut microbes and microbial derived metabolites, such as short-chain fatty acids, trimethylamine N-oxide, and lipopolysaccharides. The Gut microbiota (GM) produce neuroactives, specifically neurotransmitters that modulates local and central neuronal brain functions. An imbalance between intestinal commensals and pathobionts leads to a disruption in the gut microbiota or dysbiosis, which affects intestinal barrier integrity and gut-immune and neuroimmune systems. Currently, fecal microbiota transplantation (FMT) is recommended for the treatment of recurrent <i>Clostridioides difficile</i> infection. FMT elicits its action by ameliorating inflammatory responses through the restoration of microbial composition and functionality. Thus, FMT may be a potential therapeutic option in suppressing neuroinflammation in post-stroke conditions and other neurological disorders involving the neuroimmune axis. Specifically, FMT protects against ischemic injury by decreasing IL-17, IFN-γ, Bax, and increasing Bcl-2 expression. Interestingly, FMT improves cognitive function by lowering amyloid-β accumulation and upregulating synaptic marker (PSD-95, synapsin-1) expression in Alzheimer's disease. In Parkinson's disease, FMT was shown to inhibit the expression of TLR4 and NF-κB. In this review article, we have summarized the potential sources and methods of administration of FMT and its impact on neuroimmune and cognitive functions. We also provide a comprehensive update on the beneficial effects of FMT in various neurological disorders by undertaking a detailed interrogation of the preclinical and clinical published literature.

Also flagged:Gene Expressiongestational diabetes mellitusALDH1A1BMP4EFNB2MME
Journal Article 2024-02-21 No Snippets Chen JL, Dai HF, Kan XC, Wu J, Chen HW.
Show Full Abstract

<h4>Background</h4>Gestational diabetes mellitus (GDM), a transient disease, may lead to short- or long-term adverse influences on maternal and fetal health. Therefore, its potential functions, mechanisms and related molecular biomarkers must be comprehended for the control, diagnosis and treatment of GDM.<h4>Methods</h4>The differentially expressed genes (DEGs) were identified using GSE49524 and GSE87295 associated with GDM from the Gene Expression Omnibus database, followed by function enrichment analysis, protein-protein interactions network construction, hub DEGs mining, diagnostic value evaluation and immune infiltration analysis. Finally, hub DEGs, the strongest related to immune infiltration, were screened as immune-related biomarkers.<h4>Results</h4>A hundred and seven DEGs were identified between patients with GDM and healthy individuals. Six hub genes with high diagnostic values, including <i>ALDH1A1</i>, <i>BMP4</i>, <i>EFNB2</i>, <i>MME</i>, <i>PLAUR</i> and <i>SLIT2</i>, were identified. Among these, two immune-related genes (<i>PLAUR</i> and <i>SLIT2</i>) with the highest absolute correlation coefficient were considered immune-related biomarkers in GDM.<h4>Conclusion</h4>Our study provides a comprehensive analysis of GDM, which would provide a foundation for the development of diagnosis and treatment of GDM.

SERPINC1
Also flagged:extracellularthrombocytopeniaextracellular trapscoagulation disordersmembranecoagulation
Journal Article 2024-02-21 ✓ 5 Snippets Haus M, Foltan M, Philipp A, Mueller T, Gruber M, Lingel MP, Krenkel L, Lehle K.
In-Text Gene Mentions

…platelet counts andATIIIactivity following initiation…

…aPTT, D-dimers, fibrinogen,ATIIIactivity) and serum…

…platelet counts andATIIIactivity…

…antithrombin III activity (ATIII) ( Figure 4B…

…non-significant, increase inATIIIactivity over the…

Show Full Abstract

Neutrophil extracellular traps (NETs) have recently emerged as a potential link between inflammation, immunity, and thrombosis, as well as other coagulation disorders which present a major challenge in the context of extracorporeal membrane oxygenation (ECMO). By examining blood from ECMO patients for NETs and their precursors and correlating them with clinical and laboratory biomarkers of coagulation and inflammation, this study aims to evaluate the association between the presence of NETs in the bloodstream of ECMO patients and the development of potentially severe coagulation disorders during ECMO therapy. Therefore, blood samples were collected from healthy volunteers (n=13) and patients receiving veno-venous (VV) ECMO therapy (n=10). To identify NETs and their precursors, DNA and myeloperoxidase as well as granulocyte marker CD66b were visualized simultaneously by immunofluorescence staining in serial blood smears. Differentiation of DNA-containing objects and identification of NETs and their precursors was performed semiautomatically by a specific algorithm using the shape and size of DNA staining and the intensity of MPO and CD66b signal. Neutrophil extracellular traps and their precursors could be detected in blood smears from patients requiring VV ECMO. Compared to volunteers, ECMO patients presented significantly higher rates of NETs and NET precursors as well as an increased proportion of neutrophil granulocytes in all detected nucleated cells. A high NET rate prior to the initiation of ECMO therapy was associated with both increased IL-6 and TNF-α levels as an expression of a high cytokine burden. These patients with increased NET release also presented an earlier and significantly more pronounced decrease in platelet counts and ATIII activity following initiation of therapy compared with patients with less elevated NETs. These findings provide further indications for the development of immune-mediated acquired thrombocytopenia in ECMO patients.

Also flagged:acidosisstarchcarbohydratesresponse tocell proliferationlipopolysaccharide
Journal Article 2024-02-21 No Snippets Li W, Larsen A, Fregulia P.
Show Full Abstract

<h4>Introduction</h4>With the goal to maximize intake of high-fermentable diet needed to meet energy needs during weaning period, calves are at risk for ruminal acidosis. Using the calves from previously established model of feed-induced, ruminal acidosis in young calves, we aimed to investigate the changes in rumen epimural transcriptome and its microbial metatranscriptome at weaning (8-week) and post-weaning (17-week) in canulated (first occurred at 3 weeks of age) Holstein bull calves with feed-induced subacute ruminal acidosis.<h4>Methods</h4>Eight bull calves were randomly assigned to acidosis-inducing diet (Treated, <i>n</i> = 4; pelleted, 42.7% starch, 15.1% neutral detergent fiber [NDF], and 57.8% nonfiber carbohydrates), while texturized starter was fed as a control (Control, <i>n</i> = 4; 35.3% starch, 25.3% NDF, and 48.1% nonfiber carbohydrates) starting at 1 week through 17 weeks. Calves fed acidosis-inducing diet showed significantly less (<i>p</i> < 0.01) body weight over the course of the experiment, in addition to lower ruminal pH (<i>p</i> < 0.01) compared to the control group. Rumen epithelial (RE) tissues were collected at both 8 weeks (via biopsy) and 17 weeks (via euthanasia) and followed for whole transcriptome RNA sequencing analysis. Differentially expressed genes (DEGs) analysis was done using cufflinks2 (fold-change ≥2 and <i>p</i> < 0.05) between treated and control groups at 8-week of age, and between 8- and 17-week for the treated group.<h4>Results</h4>At 8-week of age, DEGs between treatment groups showed an enrichment of genes related to the response to lipopolysaccharide (LPS) (<i>p</i> < 0.005). The impact of prolonged, feed-induced acidosis was reflected by the decreased expression (<i>p</i> < 0.005) in genes involved in cell proliferation related pathways in the RE at 17-week of age in the treated group. Unique sets of discriminant microbial taxa were identified between 8-and 17-week calves in the treated group and the treatment groups at 8-week, indicating that active microbial community changes in the RE are an integral part of the ruminal acidosis development and progression.

HFE
Also flagged:Liver FibrosisChronic Viral Hepatitis CcytokineCD16CD94CD38
Journal Article 2024-02-21 ✓ 1 Snippet Tsukanov VV, Savchenko AA, Cherepnin MA, Kasparov EV, Tikhonova EP, Vasyutin AV, Tonkikh JL, Anisimova AA, Belenyuk VD, Borisov AG.
In-Text Gene Mentions

…ase, Wilson–Konovalov disease,hemochromatosis, autoimmune hepatitis, etc.);…

Show Full Abstract

<h4>Background</h4>NK cells phenotype and functional state in different genotypes of chronic viral hepatitis C (CVHC), depending on liver fibrosis severity, have not been sufficiently studied, which limits the possibilities for the development of pathology therapy.<h4>Methods</h4>The CVHC diagnosis was based on the EASL recommendations (2018). Clinical examination with liver elastometry was performed in 297 patients with genotype 1 and in 231 patients with genotype 3 CVHC. The blood NK cells phenotype was determined by flow cytometry in 74 individuals with genotype 1 and in 69 individuals with genotype 3 CVHC.<h4>Results</h4>The frequency of METAVIR liver fibrosis stages F3-F4 was 32.5% in individuals with genotype 3, and 20.5% in individuals with genotype 1 CVHC (<i>p</i> = 0.003). In patients with both genotype 1 and genotype 3 CVHC, a decrease in the total number of blood NK cells, CD56<sup>bright</sup>CD16<sup>+</sup> NK cells and an increase in the proportion of CD56<sup>dim</sup>CD16<sup>+</sup> NK cells, CD94<sup>+</sup> and CD38 <sup>+</sup> CD73<sup>+</sup> NK cells were registered in patients with fibrosis stage F3-F4 by METAVIR in comparison with persons with METAVIR fibrosis stage F0-F1.<h4>Conclusions</h4>In patients with both genotype 1 and genotype 3 CVHC, an imbalance in the ratio between cytokine-producing and cytotoxic NK cells and an increase in the content of NK cells that express inhibitory molecules were determined in patients with severe liver fibrosis.

DCC
Also flagged:chromosomearginineglutamineABCD4VRTNSYNDIG1L
Journal Article 2024-02-21 ✓ 1 Snippet Zhou C, Zhang Y, Ma T, Wu D, Yang Y, Wang D, Li X, Guo S, Yang S, Song Y, Zhang Y, Zuo Y, Cao G.
In-Text Gene Mentions

…genes NLGN1 ,DCC, SLC26A7 ,…

Show Full Abstract

The number of vertebrae is a crucial economic trait that can significantly impact the carcass length and meat production in animals. However, our understanding of the quantitative trait loci (QTLs) and candidate genes associated with the vertebral number in sheep (<i>Ovis aries</i>) remains limited. To identify these candidate genes and QTLs, we collected 73 Ujimqin sheep with increased numbers of vertebrae (T13L7, T14L6, and T14L7) and 23 sheep with normal numbers of vertebrae (T13L6). Through high-throughput genome resequencing, we obtained a total of 24,130,801 effective single-nucleotide polymorphisms (SNPs). By conducting a selective-sweep analysis, we discovered that the most significantly selective region was located on chromosome 7. Within this region, we identified several genes, including <i>VRTN</i>, <i>SYNDIG1L</i>, <i>LTBP2</i>, and <i>ABCD4</i>, known to regulate the spinal development and morphology. Further, a genome-wide association study (GWAS) performed on sheep with increased and normal vertebral numbers confirmed that <i>ABCD4</i> is a candidate gene for determining the number of vertebrae in sheep. Additionally, the most significant SNP on chromosome 7 was identified as a candidate QTL. Moreover, we detected two missense mutations in the <i>ABCD4</i> gene; one of these mutations (Chr7: 89393414, C > T) at position 22 leads to the conversion of arginine (Arg) to glutamine (Gln), which is expected to negatively affect the protein's function. Notably, a transcriptome expression profile in mouse embryonic development revealed that <i>ABCD4</i> is highly expressed during the critical period of vertebral formation (4.5-7.5 days). Our study highlights <i>ABCD4</i> as a potential major gene influencing the number of vertebrae in Ujimqin sheep, with promising prospects for future genome-assisted breeding improvements in sheep.

SERPINC1
Also flagged:Thrombotic DiseasesThrombosiscoagulationthrombotic diseasepathogenesisplatelet activation
Journal Article 2024-02-21 ✓ 2 Snippets Sacchetti S, Puricelli C, Mennuni M, Zanotti V, Giacomini L, Giordano M, Dianzani U, Patti G, Rolla R.
In-Text Gene Mentions

The classic, well-established genetic susceptibility factors for VTE are the variants in SERPINC1, PROC and PROS, which encode the natural anticoagulants AT, PC and PS, respectively.

…the variants inSERPINC1, PROC and PROS,…

Show Full Abstract

Thrombosis is a multifaceted process involving various molecular components, including the coagulation cascade, platelet activation, platelet-endothelial interaction, anticoagulant signaling pathways, inflammatory mediators, genetic factors and the involvement of various cells such as endothelial cells, platelets and leukocytes. A comprehensive understanding of the molecular signaling pathways and cell interactions that play a role in thrombosis is essential for the development of precise therapeutic strategies for the treatment and prevention of thrombotic diseases. Ongoing research in this field is constantly uncovering new molecular players and pathways that offer opportunities for more precise interventions in the clinical setting. These molecular insights into thrombosis form the basis for the development of targeted therapeutic approaches for the treatment and prevention of thrombotic disease. The aim of this review is to provide an overview of the pathogenesis of thrombosis and to explore new therapeutic options.

Also flagged:membranephospholipidsdigestionglycoproteinssphingolipidscholesterol
Journal Article 2024-02-21 No Snippets Nie C, Zhao Y, Wang X, Li Y, Fang B, Wang R, Wang X, Liao H, Li G, Wang P, Liu R.
Show Full Abstract

<h4>Background</h4>The milk fat globule membrane (MFGM) is a thin film that exists within the milk emulsion, suspended on the surface of milk fat globules, and comprises a diverse array of bioactive components. Recent advancements in MFGM research have sparked a growing interest in its biological characteristics and health-related functions. Thorough exploration and utilization of MFGM as a significant bioactive constituent in milk emulsion can profoundly impact human health in a positive manner. Scope and approach: This review comprehensively examines the current progress in understanding the structure, composition, physicochemical properties, methods of separation and purification, and biological activity of MFGM. Additionally, it underscores the vast potential of MFGM in the development of additives and drug delivery systems, with a particular focus on harnessing the surface activity and stability of proteins and phospholipids present on the MFGM for the production of natural emulsifiers and drug encapsulation materials.<h4>Key findings and conclusions</h4>MFGM harbors numerous active substances that possess diverse physiological functions, including the promotion of digestion, maintenance of the intestinal mucosal barrier, and facilitation of nerve development. Typically employed as a dietary supplement in infant formula, MFGM's exceptional surface activity has propelled its advancement toward becoming a natural emulsifier or encapsulation material. This surface activity is primarily derived from the amphiphilicity of polar lipids and the stability exhibited by highly glycosylated proteins.

HFE
Also flagged:Epstein-Barr Acute Viral HepatitisHyperferritinemiahepatitismyocarditisObstructive Cholangitisinfectious mononucleosis
Journal Article 2024-02-21 ✓ 5 Snippets Trivedi D, Szinte J, Hasan S, Shah SK, Saleem S.
In-Text Gene Mentions

…further investigation intohemochromatosis.…

Hemochromatosisis an autosomal…

…late manifestations ofhemochromatosis, except liver involvement,…

…to rule outhemochromatosis.…

…genetic testing forhemochromatosisand Wilson's disease…

Show Full Abstract

Epstein-Barr Virus (EBV), also known as human herpesvirus 4, is a rare cause of hepatitis and myocarditis. Severe cases of EBV hepatitis have been documented in immunocompromised cases; however, it is even more uncommonly seen in the immunocompetent population. Our case highlights EBV hepatitis presenting as acute abdominal pain in a young male with no known medical conditions.

Also flagged:Infantile Epileptic Spasms Syndromedevelopmental epileptic encephalopathyDEEepileptic spasmsEpilepsypathogenesis
Journal Article 2024-02-21 No Snippets Snyder HE, Jain P, RamachandranNair R, Jones KC, Whitney R.
Show Full Abstract

Infantile epileptic spasms syndrome (IESS) is a devastating developmental epileptic encephalopathy (DEE) consisting of epileptic spasms, as well as one or both of developmental regression or stagnation and hypsarrhythmia on EEG. A myriad of aetiologies are associated with the development of IESS; broadly, 60% of cases are thought to be structural, metabolic or infectious in nature, with the remainder genetic or of unknown cause. Epilepsy genetics is a growing field, and over 28 copy number variants and 70 single gene pathogenic variants related to IESS have been discovered to date. While not exhaustive, some of the most commonly reported genetic aetiologies include trisomy 21 and pathogenic variants in genes such as <i>TSC1</i>, <i>TSC2</i>, <i>CDKL5</i>, <i>ARX</i>, <i>KCNQ2</i>, <i>STXBP1</i> and <i>SCN2A</i>. Understanding the genetic mechanisms of IESS may provide the opportunity to better discern IESS pathophysiology and improve treatments for this condition. This narrative review presents an overview of our current understanding of IESS genetics, with an emphasis on animal models of IESS pathogenesis, the spectrum of genetic aetiologies of IESS (i.e., chromosomal disorders, single-gene disorders, trinucleotide repeat disorders and mitochondrial disorders), as well as available genetic testing methods and their respective diagnostic yields. Future opportunities as they relate to precision medicine and epilepsy genetics in the treatment of IESS are also explored.

SOX6
Also flagged:Myogenesisskeletal muscle injuryGLUT4glucose transporterNek4Pim1
Journal Article 2024-02-21 ✓ 2 Snippets Fan D, Yao Y, Liu Y, Yan C, Li F, Wang S, Yu M, Xie B, Tang Z.
In-Text Gene Mentions

…miR-208b can targetSOX6and PURB and…

…as MEETL8 andSOX6inhibiting slow myogenesis…

Show Full Abstract

Skeletal muscle plays critical roles in providing a protein source and contributing to meat production. It is well known that microRNAs (miRNAs) exert important effects on various biological processes in muscle, including cell fate determination, muscle fiber morphology, and structure development. However, the role of miRNA in skeletal muscle development remains incompletely understood. In this study, we observed a critical miRNA, miR-24-3p, which exhibited higher expression levels in Tongcheng (obese-type) pigs compared to Landrace (lean-type) pigs. Furthermore, we found that miR-24-3p was highly expressed in the dorsal muscle of pigs and the quadriceps muscle of mice. Functionally, miR-24-3p was found to inhibit proliferation and promote differentiation in muscle cells. Additionally, miR-24-3p was shown to facilitate the conversion of slow muscle fibers to fast muscle fibers and influence the expression of <i>GLUT4</i>, a glucose transporter. Moreover, in a mouse model of skeletal muscle injury, we demonstrated that overexpression of miR-24-3p promoted rapid myogenesis and contributed to skeletal muscle regeneration. Furthermore, miR-24-3p was found to regulate the expression of target genes, including <i>Nek4</i>, <i>Pim1</i>, <i>Nlk</i>, <i>Pskh1</i>, and <i>Mapk14</i>. Collectively, our findings provide evidence that miR-24-3p plays a regulatory role in myogenesis and fiber type conversion. These findings contribute to our understanding of human muscle health and have implications for improving meat production traits in livestock.

Also flagged:SchizophreniaMethylationpathological disorderpathogenesisDeoxyribonucleic acidpost-translational modification
Journal Article 2024-02-21 No Snippets Delphin N, Aust C, Griffiths L, Fernandez F.
Show Full Abstract

Despite extensive research over the last few decades, the etiology of schizophrenia (SZ) remains unclear. SZ is a pathological disorder that is highly debilitating and deeply affects the lifestyle and minds of those affected. Several factors (one or in combination) have been reported as contributors to SZ pathogenesis, including neurodevelopmental, environmental, genetic and epigenetic factors. Deoxyribonucleic acid (DNA) methylation and post-translational modification (PTM) of histone proteins are potentially contributing epigenetic processes involved in transcriptional activity, chromatin folding, cell division and apoptotic processes, and DNA damage and repair. After establishing a summary of epigenetic processes in the context of schizophrenia, this review aims to highlight the current understanding of the role of DNA methylation and histone PTMs in this disorder and their potential roles in schizophrenia pathophysiology and pathogenesis.

Also flagged:bindingpeptideswatersalthydrogenhistatin-
Journal Article 2024-02-21 No Snippets Greener JG.
Show Full Abstract

Implicit solvent force fields are computationally efficient but can be unsuitable for running molecular dynamics on disordered proteins. Here I improve the a99SB-<i>disp</i> force field and the GBNeck2 implicit solvent model to better describe disordered proteins. Differentiable molecular simulations with 5 ns trajectories are used to jointly optimise 108 parameters to better match explicit solvent trajectories. Simulations with the improved force field better reproduce the radius of gyration and secondary structure content seen in experiments, whilst showing slightly degraded performance on folded proteins and protein complexes. The force field, called GB99dms, reproduces the results of a small molecule binding study and improves agreement with experiment for the aggregation of amyloid peptides. GB99dms, which can be used in OpenMM, is available at https://github.com/greener-group/GB99dms. This work is the first to show that gradients can be obtained directly from nanosecond-length differentiable simulations of biomolecules and highlights the effectiveness of this approach to training whole force fields to match desired properties.

HTT
Also flagged:OCCompulsive DisorderBipolar Disorderanxiety disordersobsessive-compulsive disorderdepressive disorder
Journal Article 2024-02-21 ✓ 3 Snippets de Filippis R, Aguglia A, Costanza A, Benatti B, Placenti V, Vai E, Bruno E, De Berardis D, Dell'Osso B, Albert U, De Fazio P, Amore M, Serafini G, Ghaemi NS, Amerio A.
In-Text Gene Mentions

…of serotonin transporter (5-HTT) binding potential (BP)…

…specificity in targeting5-HTT.…

…BD-OCD displayed higher5-HTT-binding potential than those…

Show Full Abstract

<h4>Background</h4>Bipolar disorder (BD) and obsessive-compulsive disorder (OCD) comorbidity is an emerging condition in psychiatry, with relevant nosological, clinical, and therapeutic implications.<h4>Methods</h4>We updated our previous systematic review on epidemiology and standard diagnostic validators (including phenomenology, course of illness, heredity, biological markers, and treatment response) of BD-OCD. Relevant papers published until (and including) 15 October 2023 were identified by searching the electronic databases MEDLINE, Embase, PsychINFO, and Cochrane Library, according to the PRISMA statement (PROSPERO registration number, CRD42021267685).<h4>Results</h4>We identified 38 new articles, which added to the previous 64 and raised the total to 102. The lifetime comorbidity prevalence ranged from 0.26 to 27.8% for BD and from 0.3 to 53.3% for OCD. The onset of the two disorders appears to be often overlapping, although the appearance of the primary disorder may influence the outcome. Compared to a single diagnosis, BD-OCD exhibited a distinct pattern of OC symptoms typically following an episodic course, occurring in up to 75% of cases (vs. 3%). Notably, these OC symptoms tended to worsen during depressive episodes (78%) and improve during manic or hypomanic episodes (64%). Similarly, a BD course appears to be chronic in individuals with BD-OCD in comparison to patients without. Additionally, individuals with BD-OCD comorbidity experienced more depressive episodes (mean of 8.9 ± 4.2) compared to those without comorbidity (mean of 4.1 ± 2.7).<h4>Conclusions</h4>We found a greater likelihood of antidepressant-induced manic/hypomanic episodes (60% vs. 4.1%), and mood stabilizers with antipsychotic add-ons emerging as a preferred treatment. In line with our previous work, BD-OCD comorbidity encompasses a condition of greater nosological and clinical complexity than individual disorders.

bioRxiv 2024-02-21 Preprint (No Snippets API) Rzechorzek NM, Sutcliffe MA, Mihut A, Baranes K, Karam N, Sánchez DL, Peak-Chew SY, Zeng A, Poulin N, Seinkmane E, Karim K, Proctor CM, Kotter M, Lancaster MA, Beale AD.
Show Full Abstract

<h4>Summary</h4> Circadian rhythms result from cell-intrinsic timing mechanisms that impact health and disease 1,2 . To date, however, neural circadian research has largely focused on the hypothalamic circuitry of nocturnal rodents 3 . Whether circadian rhythms exist in human brain cells is unknown. Here we show bona fide circadian rhythms in human neurons, glia, cerebral organoids, and cerebral organoid slices (ALI-COs) 4–8 . Human neural circadian rhythms are synchronised by physiological timing cues such as glucocorticoids and daily temperature cycles, and these rhythms are temperature-compensated across the range of normal human brain temperatures 9 . Astrocyte rhythms are phase-advanced relative to other cultures and they modulate neuronal clock responses to temperature shift. Cerebral organoid rhythms are more robust at physiological brain temperatures; the relative amplitude of these rhythms increases over time in culture and their resetting capacity recapitulates key neurodevelopmental transitions in glucocorticoid signalling 10–14 . Remarkably, organoid post-transcriptional bioluminescent clock reporter rhythms are retained even when those of their putative transcriptional drivers are indiscernible 15 , and electrophysiology recordings confirm circadian rhythms in functional activity of monocultures, organoids, and ALI-COs. Around one third of the cerebral organoid proteome and phosphoproteome are circadian-rhythmic, with temporal consolidation of disease-relevant neural processes. Finally, we show that human brain organoid rhythms can be modulated and disrupted by commonly used brain-permeant drugs and mistimed cortisol exposure, respectively. Our results demonstrate that human brain cells and tissues develop their own circadian oscillations and that canonical mechanisms of the circadian clockwork may be inadequate to explain these rhythmic phenomena. 2D and 3D human neural cultures represent complementary and tractable models for exploring the emergence, disruption, and mechanics of the circadian neural clockwork, with important implications for chronobiology, brain function, and brain health.

bioRxiv 2024-02-21 Preprint (No Snippets API) Murillo A, Alpaugh M, Peter Durairaj RR, Randall EL, Larin M, Heraty L, Aston AN, Taylor AS, Monteys AM, Stöberl N, Heuchan AER, Aeschlimann P, Fears K, Landles C, Osborne GF, Mangin A, Bhattacharyya S, Metzakopian E, Allen ND, Puymirat J, Bates GP, Davidson BL, Cicchetti F, Lelos MJ, Dion V.
Show Full Abstract

Expanded CAG/CTG repeats cause over 15 different diseases that all remain without a disease-modifying treatment. Because repeat length accounts for most of the variation in disease severity, contracting them presents an attractive therapeutic avenue. Here, we show that the CRISPR-Cas9 nickase targeted to CAG/CTG repeats leads to efficient contractions in Huntington’s disease patient-derived neurons and astrocytes, and in myotonic dystrophy type 1 patient-derived neurons. The approach is allele-selective and free of detectable off-target mutations. Striatal injection of the Cas9 nickase in a mouse model for Huntington’s disease using adeno-associated viral vectors led to contractions in over half the infected cells. Upon injection, we observed a reduction in the number of inclusion bodies, improved transcriptome, and ameliorated locomotion. The effects were greater than expected from the contractions induced and suggest that non-cell autonomous mechanisms may be involved. Our results provide the proof-of-concept that correction of CAG/CTG repeats can improve Huntington’s disease phenotypes in vivo . <h4>One sentence summary</h4> The Cas9 nickase contracts CAG/CTG repeats at multiple disease loci in patient-derived cells and improves molecular and behavioral phenotypes in HD.

DCC
Also flagged:RAGEtransmembrane receptorimmunoglobulinage-related diseasesglyceraldehyde
Journal Article 2024-02-20 ✓ 1 Snippet Dascalu AE, Furman C, Landrieu I, Cantrelle FX, Mortelecque J, Grolaux G, Gillery P, Tessier F, Lipka E, Billamboz M, Boulanger E, Ghinet A.
In-Text Gene Mentions

…The affinities ofDCChits were validated…

Show Full Abstract

RAGE is a transmembrane receptor of immunoglobulin family that can bind various endogenous and exogenous ligands, initiating the inflammatory downstream signaling pathways, including inflammaging. Therefore, RAGE represents an attractive drug target for age-related diseases. For the development of small-molecule RAGE antagonists, we employed protein-templated dynamic combinatorial chemistry (ptDCC) using RAGE's VC1 domain as a template, the first application of this approach in the context of RAGE. The affinities of DCC hits were validated using microscale thermophoresis. Subsequent screening against AGE2 (glyceraldehyde-modified AGE)-sRAGE (solubleRAGE) (AGE2-BSA/sRAGE) interaction using ELISA tests led to the identification of antagonists with micromolar potency. Our findings not only demonstrate the successful application of ptDCC on RAGE but also highlight its potential to address the pressing need for alternative strategies for the development of small-molecule RAGE antagonists, an area of research that has experienced a slowdown in recent years.

BTN3A3BTN2A1
Also flagged:cancerpyrophosphateBTNBTN3A1BTN3A2gene expression
Journal Article 2024-02-20 ✓ 5 Snippets Wu Z, Lamao Q, Gu M, Jin X, Liu Y, Tian F, Yu Y, Yuan P, Gao S, Fulford TS, Uldrich AP, Wong CC, Wei W.
In-Text Gene Mentions
⭐ same-sentence co-mention

We found that four molecules belonging to the butyrophilin (BTN) family, specifically BTN2A1, BTN3A1, BTN3A2, and BTN3A3, are critically important and play unique, nonoverlapping roles in facilitating the destruction of cancer cells by primary Vγ9Vδ2 T cells.

…(BTN) family, specificallyBTN2A1, BTN3A1, BTN3A2, and…

…BTN3A1, BTN3A2, andBTN3A3, are critically important…

BTN2A1

BTN3A3

Show Full Abstract

Vγ9Vδ2 T cells are specialized effector cells that have gained prominence as immunotherapy agents due to their ability to target and kill cells with altered pyrophosphate metabolites. In our effort to understand how cancer cells evade the cell-killing activity of Vγ9Vδ2 T cells, we performed a comprehensive genome-scale CRISPR screening of cancer cells. We found that four molecules belonging to the butyrophilin (BTN) family, specifically BTN2A1, BTN3A1, BTN3A2, and BTN3A3, are critically important and play unique, nonoverlapping roles in facilitating the destruction of cancer cells by primary Vγ9Vδ2 T cells. The coordinated function of these BTN molecules was driven by synchronized gene expression, which was regulated by IFN-γ signaling and the RFX complex. Additionally, an enzyme called QPCTL was shown to play a key role in modifying the N-terminal glutamine of these BTN proteins and was found to be a crucial factor in Vγ9Vδ2 T cell killing of cancer cells. Through our research, we offer a detailed overview of the functional genomic mechanisms that underlie how cancer cells escape Vγ9Vδ2 T cells. Moreover, our findings shed light on the importance of the harmonized expression and function of gene family members in modulating T-cell activity.

Also flagged:LipidG protein-coupled receptorGPCRGPR3GPCRstransmembrane
Journal Article 2024-02-20 No Snippets Russell IC, Zhang X, Bumbak F, McNeill SM, Josephs TM, Leeming MG, Christopoulos G, Venugopal H, Flocco MM, Sexton PM, Wootten D, Belousoff MJ.
Show Full Abstract

The class A orphan G protein-coupled receptor (GPCR), GPR3, has been implicated in a variety of conditions, including Alzheimer's and premature ovarian failure. GPR3 constitutively couples with Gαs, resulting in the production of cAMP in cells. While tool compounds and several putative endogenous ligands have emerged for the receptor, its endogenous ligand, if it exists, remains a mystery. As novel potential drug targets, the structures of orphan GPCRs have been of increasing interest, revealing distinct modes of activation, including autoactivation, presence of constitutively activating mutations, or via cryptic ligands. Here, we present a cryo-electron microscopy (cryo-EM) structure of the orphan GPCR, GPR3 in complex with DNGαs and Gβ<sub>1</sub>γ<sub>2</sub>. The structure revealed clear density for a lipid-like ligand that bound within an extended hydrophobic groove, suggesting that the observed "constitutive activity" was likely due to activation via a lipid that may be ubiquitously present. Analysis of conformational variance within the cryo-EM data set revealed twisting motions of the GPR3 transmembrane helices that appeared coordinated with changes in the lipid-like density. We propose a mechanism for the binding of a lipid to its putative orthosteric binding pocket linked to the GPR3 dynamics.

Also flagged:DNMT1degradationDNMT3Bmethylationdemethylationcell divisions
Journal Article 2024-02-20 No Snippets Scelfo A, Barra V, Abdennur N, Spracklin G, Busato F, Salinas-Luypaert C, Bonaiti E, Velasco G, Bonhomme F, Chipont A, Tijhuis AE, Spierings DCJ, Guérin C, Arimondo P, Francastel C, Foijer F, Tost J, Mirny L, Fachinetti D.
Show Full Abstract

DNA methylation (DNAme) is a key epigenetic mark that regulates critical biological processes maintaining overall genome stability. Given its pleiotropic function, studies of DNAme dynamics are crucial, but currently available tools to interfere with DNAme have limitations and major cytotoxic side effects. Here, we present cell models that allow inducible and reversible DNAme modulation through DNMT1 depletion. By dynamically assessing whole genome and locus-specific effects of induced passive demethylation through cell divisions, we reveal a cooperative activity between DNMT1 and DNMT3B, but not of DNMT3A, to maintain and control DNAme. We show that gradual loss of DNAme is accompanied by progressive and reversible changes in heterochromatin, compartmentalization, and peripheral localization. DNA methylation loss coincides with a gradual reduction of cell fitness due to G1 arrest, with minor levels of mitotic failure. Altogether, this system allows DNMTs and DNA methylation studies with fine temporal resolution, which may help to reveal the etiologic link between DNAme dysfunction and human disease.

HFE
Also flagged:aryl hydrocarbon receptorAHAhRalcohol-associated hepatitistryptophanalcohol use disorder
Journal Article 2024-02-20 ✓ 1 Snippet Yamazaki T, Kouno T, Hsu CL, Hartmann P, Mayo S, Zhang X, Stärkel P, Bosques-Padilla F, Verna EC, Abraldes JG, Brown RS, Vargas V, Altamirano J, Caballería J, Shawcross DL, Louvet A, Lucey MR, Mathurin P, Garcia-Tsao G, Bataller R, Schnabl B, AlcHepNet Investigators.
In-Text Gene Mentions

Hemochromatosis

Show Full Abstract

<h4>Background and aims</h4>Patients with alcohol-associated hepatitis (AH) have an altered fecal metabolome, including reduced microbiota-derived tryptophan metabolites, which function as ligands for aryl hydrocarbon receptor (AhR). The aim of this study was to assess serum AhR ligand activity in patients with AH.<h4>Approach and results</h4>The study included 74 controls without AUD, 97 patients with AUD, and 330 patients with AH from 2 different multicenter cohorts (InTeam: 134, AlcHepNet: 196). Serum AhR activity was evaluated using an AhR reporter assay with HepG2-Lucia cells incubated with serum for 24 hours. Serum AhR activity was significantly higher in patients with AH compared with both controls (1.59 vs. 0.96-fold change, p < 0.001) and patients with AUD (1.59 vs. 0.93, p < 0.001). In both AH cohorts, patients with AhR activity ≥ 2.09 had significantly lower cumulative survival rates at 30, 60, 90, and 180 days compared to those with AhR activity < 2.09. When serum AhR activity was used to further stratify patients with severe AH, the cumulative 30, 60, 90, and 180-day survival rates for patients with severe AH and the AhR activity ≥ 2.09 group were all significantly lower than those with an AhR activity < 2.09 group.<h4>Conclusions</h4>Serum AhR activity was significantly higher in patients with AH compared with controls and individuals with AUD, and this increased activity was associated with higher mortality. Consequently, serum AhR activity holds potential as a prognostic marker.

ANKRD45
Also flagged:nucleotidegenetic disorderTEX50KRTAP19-8Keratin Associated Protein 19-8chromosome
Journal Article 2024-02-20 ✓ 1 Snippet Bollas AE, Rajkovic A, Ceyhan D, Gaither JB, Mardis ER, White P.
In-Text Gene Mentions

…genomic interval (e.g.,ANKRD45, TEX50).…

Show Full Abstract

<h4>Background</h4>Genetic ancestry, inferred from genomic data, is a quantifiable biological parameter. While much of the human genome is identical across populations, it is estimated that as much as 0.4% of the genome can differ due to ancestry. This variation is primarily characterized by single nucleotide variants (SNVs), which are often unique to specific genetic populations. Knowledge of a patient's genetic ancestry can inform clinical decisions, from genetic testing and health screenings to medication dosages, based on ancestral disease predispositions. Nevertheless, the current reliance on self-reported ancestry can introduce subjectivity and exacerbate health disparities. While genomic sequencing data enables objective determination of a patient's genetic ancestry, existing approaches are limited to ancestry inference at the continental level.<h4>Results</h4>To address this challenge, and create an objective, measurable metric of genetic ancestry we present SNVstory, a method built upon three independent machine learning models for accurately inferring the sub-continental ancestry of individuals. We also introduce a novel method for simulating individual samples from aggregate allele frequencies from known populations. SNVstory includes a feature-importance scheme, unique among open-source ancestral tools, which allows the user to track the ancestral signal broadcast by a given gene or locus. We successfully evaluated SNVstory using a clinical exome sequencing dataset, comparing self-reported ethnicity and race to our inferred genetic ancestry, and demonstrate the capability of the algorithm to estimate ancestry from 36 different populations with high accuracy.<h4>Conclusions</h4>SNVstory represents a significant advance in methods to assign genetic ancestry, opening the door to ancestry-informed care. SNVstory, an open-source model, is packaged as a Docker container for enhanced reliability and interoperability. It can be accessed from https://github.com/nch-igm/snvstory .

HTT
Also flagged:HDpsychiatric disorderssleepdeathorganizationaxons
Journal Article 2024-02-20 ✓ 3 Snippets Cano-Cano F, Martín-Loro F, Gallardo-Orihuela A, González-Montelongo MDC, Ortuño-Miquel S, Hervás-Corpión I, de la Villa P, Ramón-Marco L, Navarro-Calvo J, Gómez-Jaramillo L, Arroba AI, Valor LM.
In-Text Gene Mentions

…repeats in theHTTgene that mainly…

…1 of theHTTlocus, which triggers…

…activity of physiologicalHTTover autophagy, affecting…

Show Full Abstract

Huntington's disease (HD) is caused by an aberrant expansion of CAG repeats in the HTT gene that mainly affects basal ganglia. Although striatal dysfunction has been widely studied in HD mouse models, other brain areas can also be relevant to the pathology. In this sense, we have special interest on the retina as this is the most exposed part of the central nervous system that enable health monitoring of patients using noninvasive techniques. To establish the retina as an appropriate tissue for HD studies, we need to correlate the retinal alterations with those in the inner brain, i.e., striatum. We confirmed the malfunction of the transgenic R6/1 retinas, which underwent a rearrangement of their transcriptome as extensive as in the striatum. Although tissue-enriched genes were downregulated in both areas, a neuroinflammation signature was only clearly induced in the R6/1 retina in which the observed glial activation was reminiscent of the situation in HD patient's brains. The retinal neuroinflammation was confirmed in the slow progressive knock-in zQ175 strain. Overall, these results demonstrated the suitability of the mouse retina as a research model for HD and its associated glial activation.

Also flagged:Colorectal cancercancerplatinumirinotecantumorsmismatch repair
Journal Article 2024-02-20 No Snippets Saeed A, Park R, Pathak H, Al-Bzour AN, Dai J, Phadnis M, Al-Rajabi R, Kasi A, Baranda J, Sun W, Williamson S, Chiu YC, Osmanbeyoglu HU, Madan R, Abushukair H, Mulvaney K, Godwin AK, Saeed A.
Show Full Abstract

CAMILLA is a basket trial (NCT03539822) evaluating cabozantinib plus the ICI durvalumab in chemorefractory gastrointestinal cancer. Herein, are the phase II colorectal cohort results. 29 patients were evaluable. 100% had confirmed pMMR/MSS tumors. Primary endpoint was met with ORR of 27.6% (95% CI 12.7-47.2%). Secondary endpoints of 4-month PFS rate was 44.83% (95% CI 26.5-64.3%); and median OS was 9.1 months (95% CI 5.8-20.2). Grade≥3 TRAE occurred in 39%. In post-hoc analysis of patients with RAS wild type tumors, ORR was 50% and median PFS and OS were 6.3 and 21.5 months respectively. Exploratory spatial transcriptomic profiling of pretreatment tumors showed upregulation of VEGF and MET signaling, increased extracellular matrix activity and preexisting anti-tumor immune responses coexisting with immune suppressive features like T cell migration barriers in responders versus non-responders. Cabozantinib plus durvalumab demonstrated anti-tumor activity, manageable toxicity, and have led to the activation of the phase III STELLAR-303 trial.

SERPINC1
Also flagged:heparinmembraneclottingcoagulationclot formationcoagulation proteins
Journal Article 2024-02-20 ✓ 1 Snippet Yin EB, Bracey AW, Chatterjee S.
In-Text Gene Mentions

…blood count, INR,ATIIIlevel, bleeding and…

Show Full Abstract

<i>Background</i>: Monitoring the anticoagulant effect of unfractionated heparin (UFH) in extracorporeal membrane oxygenation (ECMO) patients is complex but critically important to balance the risks of treatment related bleeding and circuit thrombosis. While guidelines recommend using more than one method to monitor UFH activity, the use of thromboelastometry (ROTEM) to monitor UFH in ECMO patients has not been investigated in detail.<i>Methods</i>: This is an observational, single-center retrospective study looking at adult ECMO patients on UFH that had ROTEM and thromboelastography (TEG) tests obtained concurrently. A total of 20 samples were obtained from nine patients during the study period, seven of which were on veno-arterial (VA) ECMO and two of which were on veno-venous (VV) ECMO.<i>Results</i>: Under institutional standard operating practice, when TEG and/or activated partial thromboplastin time (aPTT) were considered therapeutic, intrinsic thromboelastometry clotting time (INTEM CT) was only 1.2 times higher than the normal range. TEG based monitoring compared to aPTT based monitoring tended to result in lower anti-Xa levels and less intensive anticoagulation. For the total cohort, bleeding events, driven by the need for blood transfusions, were more common compared to ischemic events (77% vs 11%; <i>p</i> = 0.02).<i>Conclusion</i>: INTEM CT tended to be less sensitive to lower doses of UFH with a value of 1.2 times higher than the normal range when aPTT and/or TEG were considered therapeutic. Due to the relative insensitivity of ROTEM, our institution decided to continue to use TEG instead of ROTEM. Larger, multicenter trials may be helpful to validate these findings.

DARS2
Also flagged:mitochondrialsynthesisprotein synthesistumortumorscell cycle
Journal Article 2024-02-20 ✓ 5 Snippets Liu XS, Liu ZY, Zeng DB, Hu J, Chen XL, Gu JL, Gao Y, Pei ZJ.
In-Text Gene Mentions

In this study, the comprehensive application of bioinformatics analysis enabled the prediction of DARS2 expression in tumors, while the regulatory capacity of DARS2 in ESCA tumor cells was successfully validated via cellular assays.

Results: DARS2 was overexpressed in various types of tumors.

The results showed a significant increase in the expression level of DARS2 in Bladder Urothelial Carcinoma (BLCA), Breast invasive carcinoma (BRCA), Cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC), Cholangiocarcinoma (CHOL), Colon adenocarcinoma (COAD), Lymphoid Neoplasm Diffuse Large B-cell Lymphoma (DLBC), Esophageal carcinoma (ESCA), Glioblastoma multiforme (GBM), Head and Neck squamous cell carcinoma (HNSC), Kidney renal papillary cell carcinoma (KIRP), Brain Lower Grade Glioma (LGG), Liver hepatocellular carcinoma (LIHC), Lung adenocarcinoma (LUAD), Lung squamous cell carcinoma (LUSC), Ovarian serous cystadenocarcinoma (OV), Pancreatic adenocarcinoma (PAAD), Prostate adenocarcinoma (PRAD), Rectum adenocarcinoma (READ), Skin Cutaneous Melanoma (SKCM), Stomach adenocarcinoma (STAD), Testicular Germ Cell Tumors (TGCT), Thymoma (THYM), Uterine Corpus Endometrial Carcinoma (UCEC) and Uterine Carcinosarcoma (UCS) compared to the normal group, while its expression level was significantly decreased in Adrenocortical carcinoma (ACC), Kidney renal clear cell carcinoma (KIRC), Acute Myeloid Leukemia (LAML) and Pheochromocytoma and Paraganglioma (PCPG) (Figure 1A, p < 0.05).

The enzyme Aspartyl tRNA synthetase 2 (DARS2) is a mitochondrial enzyme [6], and previous studies have reported its crucial role in the development of bladder cancer [7], lung adenocarcinoma [8, 9], ovarian cancer [10], and hepatocarcinogenesis [11].

In this study, we specifically focus on the relationship between DARS2 and tumor cell proliferation, migration, cell cycle, glycolysis, m6A, and ceRNA.

Show Full Abstract

<h4>Objective</h4>The enzyme Aspartyl tRNA synthetase 2 (DARS2) is a crucial enzyme in the mitochondrial tRNA synthesis pathway, playing a critical role in maintaining normal mitochondrial function and protein synthesis. However, the role of DARS2 in ESCA is unclear.<h4>Materials and methods</h4>Transcriptional data of pan-cancer and ESCA were downloaded from UCSC XENA, TCGA, and GEO databases to analyze the differential expression of DARS2 between tumor samples and normal samples, and its correlation with clinicopathological features of ESCA patients. R was used for GO, KEGG, and GSEA functional enrichment analysis of DARS2 co-expression and to analyze the connection of DARS2 with glycolysis and m6A-related genes. <i>In vitro</i> experiments were performed to assess the effects of interfering with DARS2 expression on ESCA cells. TarBase v.8, mirDIP, miRTarBase, ENCORI, and miRNet databases were used to analyze and construct a ceRNA network containing DARS2.<h4>Results</h4>DARS2 was overexpressed in various types of tumors. <i>In vitro</i> experiments confirmed that interfering with DARS2 expression significantly affected the proliferation, migration, apoptosis, cell cycle, and glycolysis of ESCA cells. DARS2 may be involved in multiple biological pathways related to tumor development. Furthermore, correlation and differential analysis revealed that DARS2 may regulate ESCA m6A modification through its interaction with METTL3 and YTHDF1. A ceRNA network containing DARS2, DLEU2/has-miR-30a-5p/DARS2, was successfully predicted and constructed.<h4>Conclusions</h4>Our findings reveal the upregulation of DARS2 in ESCA and its association with clinical features, glycolysis pathway, m6A modification, and ceRNA network. These discoveries provide valuable insights into the molecular mechanisms underlying ESCA.

GPR52
Also flagged:GPCRschizophreniapsychiatric disordersneurological diseasesG s/olf -coupled orphan G protein-coupled receptorG protein-coupled receptors
Journal Article 2024-02-20 ✓ 5 Snippets Ali S, Wang P, Murphy RE, Allen JA, Zhou J.
In-Text Gene Mentions

Excitingly, HTL0048149 (HTL'149), an orally available GPR52 agonist, has been advanced into phase I human clinical trials for the treatment of schizophrenia.

Stimulation of GPR52 activity might be beneficial for the treatment of schizophrenia, psychiatric disorders and other human neurological diseases, whereas inhibition of its activity might provide a potential therapeutic approach for Huntington's disease.

Orphan GPR52GPR52 as an…

GPR52is a highly…

…Stimulation ofGPR52activity might be…

Show Full Abstract

GPR52 is a highly conserved, brain-enriched, G<sub>s/olf</sub>-coupled orphan G protein-coupled receptor (GPCR) that controls various cyclic AMP (cAMP)-dependent physiological and pathological processes. Stimulation of GPR52 activity might be beneficial for the treatment of schizophrenia, psychiatric disorders and other human neurological diseases, whereas inhibition of its activity might provide a potential therapeutic approach for Huntington's disease. Excitingly, HTL0048149 (HTL'149), an orally available GPR52 agonist, has been advanced into phase I human clinical trials for the treatment of schizophrenia. In this concise review, we summarize the current understanding of GPR52 receptor distribution as well as its structure and functions, highlighting the recent advances in drug discovery efforts towards small-molecule GPR52 ligands. The opportunities and challenges presented by targeting GPR52 for novel therapeutics are also briefly discussed.

PTGIS
Also flagged:BioCholinecholinemetabolismphosphatidylcholineureaalanine transaminase
Journal Article 2024-02-20 ✓ 2 Snippets Mendoza-Martínez GD, Orzuna-Orzuna JF, Roque-Jiménez JA, Gloria-Trujillo A, Martínez-García JA, Sánchez-López N, Hernández-García PA, Lee-Rangel HA.
In-Text Gene Mentions

In addition to the genes that code for phospholipases, another example is the expression of the prostaglandin D2 synthase (Ptgds) and prostaglandin I2 (Ptgis) genes, which participate in pathways mediated by cyclooxygenases in immune cells from the oxidation of arachidonic acid (Figure 3) [101].

…prostaglandin I2 (Ptgis) genes, which…

Show Full Abstract

BioCholine Powder is a polyherbal feed additive composed of <i>Achyrantes aspera</i>, <i>Trachyspermum ammi</i>, <i>Azadirachta indica</i>, and <i>Citrullus colocynthis</i>. The objective of this study was to analyze published results that support the hypothesis that the polyherbal product BioCholine Powder has rumen bypass choline metabolites through a meta-analysis and effect size analysis (ES). Using Scopus, Web of Science, ScienceDirect, PubMed, and university dissertation databases, a systematic search was conducted for experiments published in scientific documents that evaluated the effects of BioCholine supplementation on the variables of interest. The analyzed data were extracted from twenty-one publications (fifteen scientific articles, three abstracts, and three graduate dissertations available in institutional libraries). The studies included lamb growing-finishing, lactating ewes and goats, calves, and dairy cows. The effects of BioCholine were analyzed using random effects statistical models to compare the weighted mean difference (WMD) between BioCholine-supplemented ruminants and controls (no BioCholine). Heterogeneity was explored, and three subgroup analyses were performed for doses [(4 (or 5 g/d), 8 (10 g/d)], supplementation in gestating and lactating ewes (pre- and postpartum supplementation), and blood metabolites by species and physiological state (lactating goats, calves, lambs, ewes). Supplementation with BioCholine in sheep increased the average daily lamb gain (<i>p</i> < 0.05), final body weight (<i>p</i> < 0.01), and daily milk yield (<i>p</i> < 0.05) without effects on intake or feed conversion. Milk yield was improved in small ruminants with BioCholine prepartum supplementation (<i>p</i> < 0.10). BioCholine supplementation decreased blood urea (<i>p</i> < 0.01) and increased levels of the liver enzymes alanine transaminase (ALT; <i>p</i> < 0.10) and albumin (<i>p</i> < 0.001). BioCholine doses over 8 g/d increased blood glucose, albumin (<i>p</i> < 0.10), cholesterol, total protein, and globulin (<i>p</i> < 0.05). The ES values of BioCholine in retained energy over the control in growing lambs were +7.15% NEm (<i>p</i> < 0.10) and +9.25% NEg (<i>p</i> < 0.10). In conclusion, adding BioCholine Powder to domestic ruminants' diets improves productive performance, blood metabolite indicators of protein metabolism, and liver health, showing its nutraceutical properties where phosphatidylcholine prevails as an alternative that can meet the choline requirements in ruminants.

Also flagged:TRIM33Co-Regulator ofERbreast cancernuclear hormone receptorestrogen
Journal Article 2024-02-20 No Snippets Romo BA, Karakyriakou B, Cressey L, Brauer BL, Yang H, Warren A, Johnson AL, Kettenbach AN, Miller TW.
Show Full Abstract

Estrogen receptor alpha (ER)-positive breast cancer is responsible for over 60% of breast cancer cases in the U.S. Among patients diagnosed with early-stage ER+ disease, 1/3 will experience recurrence despite treatment with adjuvant endocrine therapy. ER is a nuclear hormone receptor responsible for estrogen-driven tumor growth. ER transcriptional activity is modulated by interactions with coregulators. Dysregulation of the levels of these coregulators is involved in the development of endocrine resistance. To identify ER interactors that modulate transcriptional activity in breast cancer, we utilized biotin ligase proximity profiling of ER interactomes. Mass spectrometry analysis revealed tripartite motif containing 33 (TRIM33) as an estrogen-dependent interactor of ER. shRNA knockdown showed that TRIM33 promoted ER transcriptional activity and estrogen-induced cell growth. Despite its known role as an E3 ubiquitin ligase, TRIM33 increased the stability of endogenous ER in breast cancer cells. TRIM33 offers a novel target for inhibiting estrogen-induced cancer cell growth, particularly in cases of endocrine resistance driven by ER (<i>ESR1</i>) gene amplification or overexpression.

Also flagged:clustered regularly interspaced short palindromic repeatsCRISPR-associated protein 9Cas9nucleusXadrenoleukodystrophy
Journal Article 2024-02-20 No Snippets Leal AF, Herreno-Pachón AM, Benincore-Flórez E, Karunathilaka A, Tomatsu S.
Show Full Abstract

Since its discovery in 2012, the clustered regularly interspaced short palindromic repeats (CRISPR) and CRISPR-associated protein 9 (Cas9) system has supposed a promising panorama for developing novel and highly precise genome editing-based gene therapy (GT) alternatives, leading to overcoming the challenges associated with classical GT. Classical GT aims to deliver transgenes to the cells via their random integration in the genome or episomal persistence into the nucleus through lentivirus (LV) or adeno-associated virus (AAV), respectively. Although high transgene expression efficiency is achieved by using either LV or AAV, their nature can result in severe side effects in humans. For instance, an LV (NCT03852498)- and AAV9 (NCT05514249)-based GT clinical trials for treating X-linked adrenoleukodystrophy and Duchenne Muscular Dystrophy showed the development of myelodysplastic syndrome and patient's death, respectively. In contrast with classical GT, the CRISPR/Cas9-based genome editing requires the homologous direct repair (HDR) machinery of the cells for inserting the transgene in specific regions of the genome. This sophisticated and well-regulated process is limited in the cell cycle of mammalian cells, and in turn, the nonhomologous end-joining (NHEJ) predominates. Consequently, seeking approaches to increase HDR efficiency over NHEJ is crucial. This manuscript comprehensively reviews the current alternatives for improving the HDR for CRISPR/Cas9-based GTs.

DCC
Also flagged:cell cyclechromatincamptothecinDNA topoisomerase Imethyl methanesulfonatephleomycin
Journal Article 2024-02-20 ✓ 1 Snippet Siler J, Guo N, Liu Z, Qin Y, Bi X.
In-Text Gene Mentions

…factors contribute toDCCsignaling and genotoxin…

Show Full Abstract

DNA lesions trigger DNA damage checkpoint (DDC) signaling which arrests cell cycle progression and promotes DNA damage repair. In <i>Saccharomyces cerevisiae</i>, phosphorylation of histone H2A (γH2A, equivalent to γH2AX in mammals) is an early chromatin mark induced by DNA damage that is recognized by a group of DDC and DNA repair factors. We find that γH2A negatively regulates the G2/M checkpoint in response to the genotoxin camptothecin, which is a DNA topoisomerase I poison. γH2A also suppresses DDC signaling induced by the DNA alkylating agent methyl methanesulfonate. These results differ from prior findings, which demonstrate positive or no roles of γH2A in DDC in response to other DNA damaging agents such as phleomycin and ionizing radiation, which suggest that γH2A has DNA damage-specific effects on DDC signaling. We also find evidence supporting the notion that γH2A regulates DDC signaling by mediating the competitive recruitment of the DDC mediator Rad9 and the DNA repair factor Rtt107 to DNA lesions. We propose that γH2A/γH2AX serves to create a dynamic balance between DDC and DNA repair that is influenced by the nature of DNA damage.

Also flagged:GlioblastomaGBcancertumoroncogenestumors
Journal Article 2024-02-20 No Snippets Valle-Garcia D, Pérez de la Cruz V, Flores I, Salazar A, Pineda B, Meza-Sosa KF.
Show Full Abstract

Glioblastoma (GB) is the most aggressive and common type of cancer within the central nervous system (CNS). Despite the vast knowledge of its physiopathology and histology, its etiology at the molecular level has not been completely understood. Thus, attaining a cure has not been possible yet and it remains one of the deadliest types of cancer. Usually, GB is diagnosed when some symptoms have already been presented by the patient. This diagnosis is commonly based on a physical exam and imaging studies, such as computed tomography (CT) and magnetic resonance imaging (MRI), together with or followed by a surgical biopsy. As these diagnostic procedures are very invasive and often result only in the confirmation of GB presence, it is necessary to develop less invasive diagnostic and prognostic tools that lead to earlier treatment to increase GB patients' quality of life. Therefore, blood-based biomarkers (BBBs) represent excellent candidates in this context. microRNAs (miRNAs) are small, non-coding RNAs that have been demonstrated to be very stable in almost all body fluids, including saliva, serum, plasma, urine, cerebrospinal fluid (CFS), semen, and breast milk. In addition, serum-circulating and exosome-contained miRNAs have been successfully used to better classify subtypes of cancer at the molecular level and make better choices regarding the best treatment for specific cases. Moreover, as miRNAs regulate multiple target genes and can also act as tumor suppressors and oncogenes, they are involved in the appearance, progression, and even chemoresistance of most tumors. Thus, in this review, we discuss how dysregulated miRNAs in GB can be used as early diagnosis and prognosis biomarkers as well as molecular markers to subclassify GB cases and provide more personalized treatments, which may have a better response against GB. In addition, we discuss the therapeutic potential of miRNAs, the current challenges to their clinical application, and future directions in the field.

Also flagged:Gallic AcidPhloretinDiabetes mellitusmetabolic diseasehyperglycemiainsulin
Journal Article 2024-02-20 No Snippets Cassano R, Curcio F, Sole R, Mellace S, Trombino S.
Show Full Abstract

Diabetes mellitus (DM) is a metabolic disease characterized by hyperglycemia caused by abnormalities in insulin secretion and/or action. In patients with diabetes, complications such as blindness, delayed wound healing, erectile dysfunction, renal failure, heart disease, etc., are generally related to an increase in ROS levels which, when activated, trigger hyperglycemia-induced lesions, inflammation and insulin resistance. In fact, extensive cell damage and death occurs mainly due to the effect that ROS exerts at the level of cellular constituents, causing the deterioration of DNA and peroxidation of proteins and lipids. Furthermore, elevated levels of reactive oxygen species (ROS) and an imbalance of redox levels in diabetic patients produce insulin resistance. These destructive effects can be controlled by the defense network of antioxidants of natural origin such as phloretin and gallic acid. For this reason, the objective of this work was to create a nanocarrier (hydrogel) based on gallic acid containing phloretin to increase the antioxidant effect of the two substances which function as fundamental for reducing the mechanisms linked to oxidative stress in patients suffering from chronic diabetes. Furthermore, since the bioavailability problems of phloretin at the intestinal level are known, this carrier could facilitate its release and absorption. The obtained hydrogel was characterized using Fourier transform infrared spectroscopy (FT-IR). Its degree of swelling (a%) and phloretin release were tested under pH conditions simulating the gastric and intestinal environment (1.2, 6.8 and 7.4). The antioxidant activity, inhibiting lipid peroxidation in rat liver microsomal membranes induced in vitro by a free radical source, was evaluated for four hours. All results showed that gallate hydrogel could be applied for releasing intestinal phloretin and reducing the ROS levels.

CSE1L
Also flagged:fatty acidmetabolismlung squamous cell carcinomaLUSCGene Expressionhuman leukocyte antigen
Journal Article 2024-02-20 ✓ 1 Snippet Xu J, Yu M, Fan W, Feng J.
In-Text Gene Mentions

…which could bindCSE1Lto promote cell…

Show Full Abstract

<h4>Background</h4>Dysregulation of fatty acid metabolism (FAM) represents a significant metabolic alteration in tumorigenesis. However, the role of FAM-related genes (FAMRGs) in early-stage lung squamous cell carcinoma (LUSC) remains incompletely understood.<h4>Methods</h4>A series of bioinformatic analyses and machine learning strategies were performed to construct a FAMRGs-based signature to predict prognosis and guide personalized treatment for early-stage LUSC patients. FAMRGs were screened through the Kyoto Encyclopedia of Genes and Genomes (KEGG) database and the Molecular Signature Database (MSigDB). Prognosis FAMRGs were identified using univariate Cox regression, and unsupervised clustering analysis facilitated the division of the cohort into different clusters. The least absolute shrinkage and selection operator (LASSO)-Cox regression and multivariate regression analysis were employed to develop a FAMRGs-based signature for predicting overall survival (OS). A nomogram was subsequently constructed to facilitate risk assessment for individual patients. Comprehensive analyses of metabolic pathways, immune infiltration, immunomodulators, and potentially applicable drugs were conducted across different FAMRGs-related risk groups.<h4>Results</h4>The FAMRGs-based signature, comprising nine genes (<i>ACOT11, APOH, BMX, CYP2R1, DPEP3, FABP6, FADS2, GLYATL2,</i> and <i>THRSP</i>), demonstrated robust predictive capabilities for prognosis in The Cancer Genome Atlas (TCGA)-LUSC dataset and validated across six independent Gene Expression Omnibus (GEO)-LUSC datasets. Notably, the FAMRGs-base signature exhibited superior prognostic capacity and accurate survival prediction compared to conventional clinicopathological features. Furthermore, the signature was closely associated with immune cell infiltration, human leukocyte antigen (HLA) genes, and immune checkpoint genes expression. Additionally, the signature demonstrated potential sensitivity to chemo-/target-therapy.<h4>Conclusions</h4>The FAMRGs-based signature demonstrated superior sensitivity in predicting the prognosis of early-stage LUSC. Detecting FAMRGs may provide predictive targets for the development of clinical treatment strategies.

HFE
Also flagged:Ferritinironinfectiongestationrespiratory distress syndromeinfections
Journal Article 2024-02-20 ✓ 1 Snippet Dande A, Pajai S, Gupta A, Dande S, Sethi N.
In-Text Gene Mentions

…example is theHFEgene, associated with…

Show Full Abstract

Preterm delivery remains a critical global health concern, with numerous adverse consequences for both neonate and healthcare systems. Understanding the relationship between maternal ferritin levels, as a marker of iron status, and the risk of preterm birth is the focal point of this comprehensive review. We provide insights into the multifaceted nature of this connection, highlighting factors that influence maternal ferritin levels, including dietary intake, genetic and physiological variations, comorbidities, and iron supplementation. While evidence suggests an association between low maternal ferritin levels and preterm birth, causality remains elusive, necessitating further research with robust study designs. The potential mechanisms linking maternal iron status to preterm birth, such as inflammation, infection, and oxidative stress, are explored, underscoring the need for in-depth investigations. This comprehensive review emphasizes the clinical importance of assessing and monitoring maternal ferritin levels in prenatal care and advocates for public health initiatives to raise awareness and provide targeted interventions, particularly in high-risk populations. As we strive to address these unanswered questions and embark on innovative research directions, the aim is to ultimately enhance our understanding of the complex relationship between maternal iron status and preterm birth, leading to improved maternal and child health outcomes.

HTT
Also flagged:transmembraneCD9CD63CD81vesiclesmembrane-sensing
Journal Article 2024-02-19 ✓ 2 Snippets Herman M, Randall GW, Spiegel JL, Maldonado DJ, Simoes S.
In-Text Gene Mentions

In vitro and in vivo research using HD models suggests a role for endogenous HTT in endosome motility, tubulation, and recycling through interactions with members of the Rab family (e.g. Rabs 4, 5, 11 and HDP40).

Although a link between HD and endo-lysosomal dysfunction has been recognized in the field, it remains unclear how the endogenous and pathogenic huntingtin (HTT) proteins are related to certain aspects of this intracellular pathway, in both normal and disease state.

Show Full Abstract

Over the past two decades, increased research has highlighted the connection between endosomal trafficking defects and neurodegeneration. The endo-lysosomal network is an important, complex cellular system specialized in the transport of proteins, lipids, and other metabolites, essential for cell homeostasis. Disruption of this pathway is linked to a wide range of neurodegenerative diseases, including Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, Huntington's disease and frontotemporal dementia. Furthermore, there is strong evidence that defects in this pathway create opportunities for diagnostic and therapeutic intervention. In this <i>Opinion</i> piece, we concisely address the role of endo-lysosomal dysfunction in five neurodegenerative diseases and discuss how future research can investigate this intracellular pathway, including extracellular vesicles with a specific focus on exosomes for the identification of novel disease biomarkers. This article is part of a discussion meeting issue 'Understanding the endo-lysosomal network in neurodegeneration'.

ZNFX1
Also flagged:NSCLClung cancertumortumorscancerNon-small cell lung cancer
Journal Article 2024-02-19 ✓ 1 Snippet Wang Y, Dong A, Jin M, Li S, Duan Y.
In-Text Gene Mentions

ZNFX1antisense RNA 1…

Show Full Abstract

<h4>Background</h4>Non-small cell lung cancer (NSCLC) is the most common type of lung cancer (LC), which is the leading cause of tumor mortality. In recent years, compared with tissue biopsy, which is the diagnostic gold standard for tumor diagnosis, Liquid biopsy (LB) is considered to be a more minimally invasive, sensitive, and safer alternative or auxiliary diagnostic method. However, the current value of LB in early diagnosis of LC is not ideal, so it is particularly important to study the changes in blood composition during the process of tumorigenesis and find more sensitive biomarkers.<h4>Purpose</h4>Platelets are a type of abundant blood cells that carry a large amount of RNA. In the LC regulatory network, activated platelets play an important role in the process of tumorigenesis, development, and metastasis. In order to identify predictive liquid biopsy biomarkers for the diagnosis of NSCLC, we summarized the development and function of platelets, the interaction between platelets and tumors, the value of TEP RNA in diagnosis, prognosis, and treatment of NSCLC, and the method for detecting TEP RNA of NSCLC in this article.<h4>Conclusion</h4>The application of platelets in the diagnosis and treatment of NSCLC remains at a nascent stage. In addition to the drawbacks of low platelet count and complex experimental processes, the diagnostic accuracy of TEP RNA-seq for cancer in different populations still needs to be improved and validated. At present, a large number of studies have confirmed significant differences in the expression of TEP RNA in platelets between NSCLC patients and healthy individuals. Continuous exploration of the diagnostic value of TEP RNA in NSCLC is of utmost importance. The integration of NSCLC platelet-related markers with other NSCLC markers can improve current tumor diagnosis and prognostic evaluation systems, providing broad prospects in tumor screening, disease monitoring, and prognosis assessment.

SOX6
Also flagged:Cas9p65RtadCas9VPRCAG
Journal Article 2024-02-19 ✓ 5 Snippets Karbassi E, Padgett R, Bertero A, Reinecke H, Klaiman JM, Yang X, Hauschka SD, Murry CE.
In-Text Gene Mentions

…either PPARGC1B orSOX6, and non-targeting…

…PPARGC1B andSOX6genes have been…

…endogenous PPARGC1B andSOX6were introduced into…

…native PPARCG1B andSOX6gene expression after…

…genes, PPARGC1B andSOX6, were not…

Show Full Abstract

Human induced pluripotent stem cells (hiPSCs) offer opportunities to study human biology where primary cell types are limited. CRISPR technology allows forward genetic screens using engineered Cas9-expressing cells. Here, we sought to generate a CRISPR activation (CRISPRa) hiPSC line to activate endogenous genes during pluripotency and differentiation. We first targeted catalytically inactive Cas9 fused to VP64, p65 and Rta activators (dCas9-VPR) regulated by the constitutive CAG promoter to the AAVS1 safe harbor site. These CRISPRa hiPSC lines effectively activate target genes in pluripotency, however the dCas9-VPR transgene expression is silenced after differentiation into cardiomyocytes and endothelial cells. To understand this silencing, we systematically tested different safe harbor sites and different promoters. Targeting to safe harbor sites hROSA26 and CLYBL loci also yielded hiPSCs that expressed dCas9-VPR in pluripotency but silenced during differentiation. Muscle-specific regulatory cassettes, derived from cardiac troponin T or muscle creatine kinase promoters, were also silent after differentiation when dCas9-VPR was introduced. In contrast, in cell lines where the dCas9-VPR sequence was replaced with cDNAs encoding fluorescent proteins, expression persisted during differentiation in all loci and with all promoters. Promoter DNA was hypermethylated in CRISPRa-engineered lines, and demethylation with 5-azacytidine enhanced dCas9-VPR gene expression. In summary, the dCas9-VPR cDNA is readily expressed from multiple loci during pluripotency but induces silencing in a locus- and promoter-independent manner during differentiation to mesoderm derivatives. Researchers intending to use this CRISPRa strategy during stem cell differentiation should pilot their system to ensure it remains active in their population of interest.

SOX6OLFM4
Also flagged:chronic inflammatory disorder of theVedolizumabantibodyɑ 4 β 7 integrinbindingmucosal addressin-cell adhesion molecule 1
Journal Article 2024-02-19 ✓ 2 Snippets Mennillo E, Kim YJ, Lee G, Rusu I, Patel RK, Dorman LC, Flynn E, Li S, Bain JL, Andersen C, Rao A, Tamaki S, Tsui J, Shen A, Lotstein ML, Rahim M, Naser M, Bernard-Vazquez F, Eckalbar W, Cho SJ, Beck K, El-Nachef N, Lewin S, Selvig DR, Terdiman JP, Mahadevan U, Oh DY, Fragiadakis GK, Pisco A, Combes AJ, Kattah MG.
In-Text Gene Mentions

…CXCL14, ENHO, PDGRFA,SOX6, and surface…

…base including REG1A,OLFM4, AGR2, SPINK1 ,…

Show Full Abstract

Ulcerative colitis (UC) is driven by immune and stromal subsets, culminating in epithelial injury. Vedolizumab (VDZ) is an anti-integrin antibody that is effective for treating UC. VDZ is known to inhibit lymphocyte trafficking to the intestine, but its broader effects on other cell subsets are less defined. To identify the inflammatory cells that contribute to colitis and are affected by VDZ, we perform single-cell transcriptomic and proteomic analyses of peripheral blood and colonic biopsies in healthy controls and patients with UC on VDZ or other therapies. Here we show that VDZ treatment is associated with alterations in circulating and tissue mononuclear phagocyte (MNP) subsets, along with modest shifts in lymphocytes. Spatial multi-omics of formalin-fixed biopsies demonstrates trends towards increased abundance and proximity of MNP and fibroblast subsets in active colitis. Spatial transcriptomics of archived specimens pre-treatment identifies epithelial-, MNP-, and fibroblast-enriched genes related to VDZ responsiveness, highlighting important roles for these subsets in UC.

DDX27
Also flagged:RNA-binding proteinsRNase Hribosomebindingoligonucleotidespenicillin
Journal Article 2024-02-19 ✓ 1 Snippet Dodel M, Guiducci G, Dermit M, Krishnamurthy S, Alard EL, Capraro F, Rekad Z, Stojic L, Mardakheh FK.
In-Text Gene Mentions

…them, we identifiedDDX27—a DEAD box helicase…

Show Full Abstract

Different regions of RNA molecules can often engage in specific interactions with distinct RNA-binding proteins (RBPs), giving rise to diverse modalities of RNA regulation and function. However, there are currently no methods for unbiased identification of RBPs that interact with specific RNA regions in living cells and under endogenous settings. Here we introduce TREX (targeted RNase H-mediated extraction of crosslinked RBPs)-a highly sensitive approach for identifying proteins that directly bind to specific RNA regions in living cells. We demonstrate that TREX outperforms existing methods in identifying known interactors of U1 snRNA, and reveals endogenous region-specific interactors of NORAD long noncoding RNA. Using TREX, we generated a comprehensive region-by-region interactome for 45S rRNA, uncovering both established and previously unknown interactions that regulate ribosome biogenesis. With its applicability to different cell types, TREX is an RNA-centric tool for unbiased positional mapping of endogenous RNA-protein interactions in living cells.

HFE
Also flagged:BreastOvarian CancerHypercholesterolemiahereditary breast cancerdislipidemiascardiomyopathies
Journal Article 2024-02-19 ✓ 5 Snippets Venner E, Patterson K, Kalra D, Wheeler MM, Chen YJ, Kalla SE, Yuan B, Karnes JH, Walker K, Smith JD, McGee S, Radhakrishnan A, Haddad A, Empey PE, Wang Q, Lichtenstein L, Toledo D, Jarvik G, Musick A, Gibbs RA, All of Us Research Program Investigators.
In-Text Gene Mentions

…hereditary breast cancer,hemochromatosis, dislipidemias and cardiomyop…

…InHFE, only the…

…Interestingly, the genesHFEand PALB2 differences…

…close match forhemochromatosis, which had the…

…Only the commonHFErs1800562 alleles, in…

Show Full Abstract

Disparities in data underlying clinical genomic interpretation is an acknowledged problem, but there is a paucity of data demonstrating it. The All of Us Research Program is collecting data including whole-genome sequences, health records, and surveys for at least a million participants with diverse ancestry and access to healthcare, representing one of the largest biomedical research repositories of its kind. Here, we examine pathogenic and likely pathogenic variants that were identified in the All of Us cohort. The European ancestry subgroup showed the highest overall rate of pathogenic variation, with 2.26% of participants having a pathogenic variant. Other ancestry groups had lower rates of pathogenic variation, including 1.62% for the African ancestry group and 1.32% in the Latino/Admixed American ancestry group. Pathogenic variants were most frequently observed in genes related to Breast/Ovarian Cancer or Hypercholesterolemia. Variant frequencies in many genes were consistent with the data from the public gnomAD database, with some notable exceptions resolved using gnomAD subsets. Differences in pathogenic variant frequency observed between ancestral groups generally indicate biases of ascertainment of knowledge about those variants, but some deviations may be indicative of differences in disease prevalence. This work will allow targeted precision medicine efforts at revealed disparities.

HTT
Also flagged:glutaminesgene expressionHDSpt5Pol IImitochondrial
Journal Article 2024-02-19 ✓ 5 Snippets Bahat A, Itzhaki E, Weiss B, Tolmasov M, Tsoory M, Kuperman Y, Brandis A, Shurrush KA, Dikstein R.
In-Text Gene Mentions

Selective downregulation of the mutant Htt gene expression is considered the most promising therapeutic approach for HD.

This is in line with no detectable effect on the Htt protein level upon prolonged treatment with the pump (Fig. EV5D), and no improvement in the anxiety symptoms (Fig. EV5B).

Currently there are no effective treatments to delay the onset or slow the progression of the disease and lowering the levels of the Htt gene is among the most promising therapeutic strategies for HD.

Huntington’s disease (HD) is a devastating genetic disorder caused by an expansion of trinucleotide repeat (CAG) in the first exon of the Huntingtin gene (Htt).

Using the established BACHD mouse model of HD, we demonstrate the ability of SPI-24 and SPI-77 to pass the blood-brain barrier and to lower mutant Htt mRNA and protein levels in the striatum.

Show Full Abstract

Huntington's disease (HD) is an incurable inherited disorder caused by a repeated expansion of glutamines in the huntingtin gene (Htt). The mutant protein causes neuronal degeneration leading to severe motor and psychological symptoms. Selective downregulation of the mutant Htt gene expression is considered the most promising therapeutic approach for HD. We report the identification of small molecule inhibitors of Spt5-Pol II, SPI-24 and SPI-77, which selectively lower mutant Htt mRNA and protein levels in HD cells. In the BACHD mouse model, their direct delivery to the striatum diminished mutant Htt levels, ameliorated mitochondrial dysfunction, restored BDNF expression, and improved motor and anxiety-like phenotypes. Pharmacokinetic studies revealed that these SPIs pass the blood-brain-barrier. Prolonged subcutaneous injection or oral administration to early-stage mice significantly delayed disease deterioration. SPI-24 long-term treatment had no side effects or global changes in gene expression. Thus, lowering mutant Htt levels by small molecules can be an effective therapeutic strategy for HD.

BTN2A1
Also flagged:cancerMHCsolid cancerslipidmajortumour
Journal Article 2024-02-19 ✓ 1 Snippet Revesz IA, Joyce P, Ebert LM, Prestidge CA.
In-Text Gene Mentions

…heterodimer conformation withBTN2A1, as has been…

Show Full Abstract

γδ T cells are a unique subset of T lymphocytes, exhibiting features of both innate and adaptive immune cells and are involved with cancer immunosurveillance. They present an attractive alternative to conventional T cell-based immunotherapy due, in large part, to their lack of major histocompatibility (MHC) restriction and ability to secrete high levels of cytokines with well-known anti-tumour functions. To date, clinical trials using γδ T cell-based immunotherapy for a range of haematological and solid cancers have yielded limited success compared with <i>in vitro</i> studies. This inability to translate the efficacy of γδ T-cell therapies from preclinical to clinical trials is attributed to a combination of several factors, e.g. γδ T-cell agonists that are commonly used to stimulate populations of these cells have limited cellular uptake yet rely on intracellular mechanisms; administered γδ T cells display low levels of tumour-infiltration; and there is a gap in the understanding of γδ T-cell inhibitory receptors. This review explores the discrepancy between γδ T-cell clinical and preclinical performance and offers viable avenues to overcome these obstacles. Using more direct γδ T-cell agonists, encapsulating these agonists into lipid nanocarriers to improve their pharmacokinetic and pharmacodynamic profiles and the use of combination therapies to overcome checkpoint inhibition and T-cell exhaustion are ways to bridge the gap between preclinical and clinical success. Given the ability to overcome these limitations, the development of a more targeted γδ T-cell agonist-checkpoint blockade combination therapy has the potential for success in clinical trials which has to date remained elusive.

DCC
Also flagged:Acetylcholinenetrin-1netrin receptor-in-colorectal cancermuscarinic receptorsmembrane
Journal Article 2024-02-19 ✓ 3 Snippets Glasgow SD, Fisher TAJ, Wong EW, Lançon K, Feighan KM, Beamish IV, Gibon J, Séguéla P, Ruthazer ES, Kennedy TE.
In-Text Gene Mentions

…deleted-in-colorectal cancer (DCC) from forebrain excitatory…

…either netrin-1 orDCCinhibits cholinergic persisten…

…firing by recruitingDCCto the plasma…

Show Full Abstract

The ability of the mammalian brain to maintain spatial representations of external or internal information for short periods of time has been associated with sustained neuronal spiking and reverberatory neural network activity in the medial entorhinal cortex. Here, we show that conditional genetic deletion of netrin-1 or the netrin receptor deleted-in-colorectal cancer (DCC) from forebrain excitatory neurons leads to deficits in short-term spatial memory. We then demonstrate that conditional deletion of either netrin-1 or DCC inhibits cholinergic persistent firing and show that cholinergic activation of muscarinic receptors expressed by entorhinal cortical neurons promotes persistent firing by recruiting DCC to the plasma membrane. Together, these findings indicate that normal short-term spatial memory function requires the synergistic actions of acetylcholine and netrin-1.

HTT
Also flagged:OligonucleotideSpinal muscular atrophySurvival Motor NeuronSMNgene expressionMuscular Atrophy
Journal Article 2024-02-19 ✓ 1 Snippet Ottesen EW, Singh RN.
In-Text Gene Mentions

HTT, XRN2 ,…

Show Full Abstract

Spinal muscular atrophy (SMA) is treated by increasing the level of Survival Motor Neuron (SMN) protein through correction of <i>SMN2</i> exon 7 skipping or exogenous expression of SMN through gene therapy. Currently available therapies have multiple shortcomings, including poor body-wide distribution, invasive delivery, and potential negative consequences due to high doses needed for clinical efficacy. Here we test the effects of a combination treatment of a splice-correcting antisense oligonucleotide (ASO) Anti-N1 with the small compounds risdiplam and branaplam. We show that a low-dose treatment of Anti-N1 with either compound produces a synergistic effect on the inclusion of <i>SMN2</i> exon 7 in SMA patient fibroblasts. Using RNA-Seq, we characterize the transcriptomes of cells treated with each compound as well as in combination. Although high doses of each individual treatment trigger widespread perturbations of the transcriptome, combination treatment of Anti-N1 with risdiplam and branaplam results in minimal disruption of gene expression. For individual genes targeted by the 3 compounds, we observe little to no additive effects of combination treatment. Overall, we conclude that the combination treatment of a splice-correcting ASO with small compounds represents a promising strategy for achieving a high level of SMN expression while minimizing the risk of off-target effects.

TNFSF4
Also flagged:GlioblastomatemozolomidetumorGBMbrain tumorchemokine receptors
Journal Article 2024-02-19 ✓ 2 Snippets Morimoto T, Nakazawa T, Matsuda R, Maeoka R, Nishimura F, Nakamura M, Yamada S, Park YS, Tsujimura T, Nakagawa I.
In-Text Gene Mentions

…MICA, NCR3LG1, NID1/PDGFD,TNFSF4, and TNFSF9, ligands…

…the expression ofTNFSF4and NCR3LG1 was…

Show Full Abstract

Despite standard multimodality treatment, containing maximum safety resection, temozolomide, radiotherapy, and a tumor-treating field, patients with glioblastoma (GBM) present with a dismal prognosis. Natural killer cell (NKC)-based immunotherapy would play a critical role in GBM treatment. We have previously reported highly activated and ex vivo expanded NK cells derived from human peripheral blood, which exhibited anti-tumor effect against GBM cells. Here, we performed preclinical evaluation of the NK cells using an in vivo orthotopic xenograft model, the U87MG cell-derived brain tumor in NOD/Shi-scid, IL-2RɤKO (NOG) mouse. In the orthotopic xenograft model, the retro-orbital venous injection of NK cells prolonged overall survival of the NOG mouse, indirectly indicating the growth-inhibition effect of NK cells. In addition, we comprehensively summarized the differentially expressed genes, especially focusing on the expression of the NKC-activating receptors' ligands, inhibitory receptors' ligands, chemokines, and chemokine receptors, between murine brain tumor treated with NKCs and with no agents, by using microarray. Furthermore, we also performed differentially expressed gene analysis between an internal and external brain tumor in the orthotopic xenograft model. Our findings could provide pivotal information for the NK-cell-based immunotherapy for patients with GBM.

TAOK3
Also flagged:STE20-Type KinaseMST4Metabolic dysfunction-associated steatotic liver diseasemetabolic dysfunction-associated steatohepatitischronic liver diseaseSTE20-type protein kinase
Journal Article 2024-02-19 ✓ 3 Snippets Caputo M, Andersson E, Xia Y, Hou W, Cansby E, Erikson M, Lind DE, Hallberg B, Amrutkar M, Mahlapuu M.
In-Text Gene Mentions

Similarly to MST4 [18], STK25 and MST3 (comprising the GCK-III subfamily of STE20 kinases together with MST4), MAP4K4 (belonging to the GCK-IV subfamily), as well as TAOK1 and TAOK3 (GCK-VIII subfamily members) have been identified as important drivers of hepatocellular lipotoxicity based on expression profiling in human liver biopsies, which demonstrates that their mRNA abundance is positively correlated with the key histological features of MASLD, and via in vitro investigations in cultured hepatocytes, which reveal that the knockdown of their respective genes alleviates fat accumulation by causing a shift from lipid anabolism towards catabolism [18,36,37,38,39,40,41].

…as TAOK1 andTAOK3(GCK-VIII subfamily members)…

…MAP4K4, TAOK1, orTAOK3when comparing the…

Show Full Abstract

Metabolic dysfunction-associated steatotic liver disease (MASLD) and its advanced subtype, metabolic dysfunction-associated steatohepatitis (MASH), have emerged as the most common chronic liver disease worldwide, yet there is no targeted pharmacotherapy presently available. This study aimed to investigate the possible in vivo function of STE20-type protein kinase MST4, which was earlier implicated in the regulation of hepatocellular lipotoxic milieu in vitro, in the control of the diet-induced impairment of systemic glucose and insulin homeostasis as well as MASLD susceptibility. Whole-body and liver-specific <i>Mst4</i> knockout mice were generated by crossbreeding conditional <i>Mst4</i><sup>fl/fl</sup> mice with mice expressing Cre recombinase under the <i>Sox2</i> or <i>Alb</i> promoters, respectively. To replicate the environment in high-risk subjects, <i>Mst4</i><sup>-/-</sup> mice and their wild-type littermates were fed a high-fat or a methionine-choline-deficient (MCD) diet. Different in vivo tests were conducted in obese mice to describe the whole-body metabolism. MASLD progression in the liver and lipotoxic damage to adipose tissue, kidney, and skeletal muscle were analyzed by histological and immunofluorescence analysis, biochemical assays, and protein and gene expression profiling. In parallel, intracellular fat storage and oxidative stress were assessed in primary mouse hepatocytes, where MST4 was silenced by small interfering RNA. We found that global MST4 depletion had no effect on body weight or composition, locomotor activity, whole-body glucose tolerance or insulin sensitivity in obese mice. Furthermore, we observed no alterations in lipotoxic injuries to the liver, adipose, kidney, or skeletal muscle tissue in high-fat diet-fed whole-body <i>Mst4</i><sup>-/-</sup> vs. wild-type mice. Liver-specific <i>Mst4</i><sup>-/-</sup> mice and wild-type littermates displayed a similar severity of MASLD when subjected to an MCD diet, as evidenced by equal levels of steatosis, inflammation, hepatic stellate cell activation, fibrosis, oxidative/ER stress, and apoptosis in the liver. In contrast, the in vitro silencing of MST4 effectively protected primary mouse hepatocytes against ectopic lipid accumulation and oxidative cell injury triggered by exposure to fatty acids. In summary, these results suggest that the genetic ablation of MST4 in mice does not mitigate the initiation or progression of MASLD and has no effect on systemic glucose or insulin homeostasis in the context of nutritional stress. The functional compensation for the genetic loss of MST4 by yet undefined mechanisms may contribute to the apparent discrepancy between in vivo and in vitro phenotypic consequences of MST4 silencing.

HTT
Also flagged:JNKc-Jun N-terminal kinasec-Junmitogen-activated protein kinaseMAPKstress-activated kinase
Journal Article 2024-02-19 ✓ 3 Snippets Yan H, He L, Lv, Yang J, Yuan Z.
In-Text Gene Mentions

MAPK: mitogen-activated protein kinase; JNK, c-Jun N-terminal kinase; ERK, extracellular signal-regulated kinase; SAPK, stress-activated MAP kinase; MLK, mixed-lineage protein kinase; ASK, apoptosis signal-regulating kinase; JIP, JNK-interacting protein; IKAP, the IκB kinase complex-associated protein; ACID, amyloid precursor protein intracellular domain; Notch-IC, Notch intracellular domain; DUSP1, dual specificity protein phosphatase; Sab, SH3 homology-associated BTK-binding protein; HPK, hematopoietic progenitor kinase; GCK, STE20 protein homologue germinal center kinase; NIK, Nck interacting kinase; ATF2, activating transcription factor 2; Elk1, ETS like-1 protein; HFD, high-fat diet; FFA, free fatty acid; T2D, type II diabetes; IRS, insulin receptor substrate; PI3K, phosphatidylinositide 3 kinase; TSH, thyroid-stimulating hormone; T3, triiodothyronine; T4, thyroxine; Dio2, type-2 deiodinase; CMS, cardiometabolic syndrome; LDL, low-density lipoprotein; LDLR, low-density lipoprotein receptor; NASH, Non-alcoholic steatohepatitis; CNS, central nervous system; SAB, SH3 homology-associated BTK-binding protein; MN, motor neuron; HTT, huntingtin protein; PD, Parkinson’s disease; AD, Alzheimer’s disease; HD, Huntington’s disease; KLF9, Kluppel-like transcription factor 9; OSCC, oral squamous cell carcinoma; EAE, experimental autoimmune encephalomyelitis; AAA, abdominal aortic aneurysm; and ADPKD, autosomal dominant polycystic kidney disease.

In HD patients, there are some amplifications of glutamine repeat (poly Q) in huntingtin protein (HTT), which trigger protein aggregation and neuronal degeneration [130].

…MN, motor neuron;HTT, huntingtin protein; PD,…

Show Full Abstract

JNK is named after c-Jun N-terminal kinase, as it is responsible for phosphorylating c-Jun. As a member of the mitogen-activated protein kinase (MAPK) family, JNK is also known as stress-activated kinase (SAPK) because it can be activated by extracellular stresses including growth factor, UV irradiation, and virus infection. Functionally, JNK regulates various cell behaviors such as cell differentiation, proliferation, survival, and metabolic reprogramming. Dysregulated JNK signaling contributes to several types of human diseases. Although the role of the JNK pathway in a single disease has been summarized in several previous publications, a comprehensive review of its role in multiple kinds of human diseases is missing. In this review, we begin by introducing the landmark discoveries, structures, tissue expression, and activation mechanisms of the JNK pathway. Next, we come to the focus of this work: a comprehensive summary of the role of the deregulated JNK pathway in multiple kinds of diseases. Beyond that, we also discuss the current strategies for targeting the JNK pathway for therapeutic intervention and summarize the application of JNK inhibitors as well as several challenges now faced. We expect that this review can provide a more comprehensive insight into the critical role of the JNK pathway in the pathogenesis of human diseases and hope that it also provides important clues for ameliorating disease conditions.

Also flagged:proanthocyanidinssaponinspolyphenolflavonoidcarotenoidcardiovascular disease
Journal Article 2024-02-19 No Snippets Boev M, Stănescu C, Turturică M, Cotârleţ M, Batîr-Marin D, Maftei N, Chiţescu C, Grigore-Gurgu L, Barbu V, Enachi E, Lisă EL.
Show Full Abstract

The primary goal of this study was to generate different kinds of functional products based on carrots that were supplemented with lactic acid bacteria. The fact that carrots (<i>Daucus carota</i> sp.) rank among the most popular vegetables in our country led to the convergence of the research aim. Their abundance of bioactive compounds, primarily polyphenols, flavonoids, and carotenoids, offers numerous health benefits. Among the obtained products, the freeze-dried carrot powder (<i>FDCP</i>) variation presented the highest concentrations of total carotenoids (<i>TCs</i>) and <i>β</i>-carotene (<i>BC</i>) of 26.977 ± 0.13 mg/g DW and 22.075 ± 0.14 mg/g DW, respectively. The amount of total carotenoids and <i>β</i>-carotene significantly increased with the addition of the selected lactic acid bacteria (LAB) for most of the samples. In addition, a slight increase in the antioxidant activity compared with the control sample for the <i>FDCP</i> variant, with the highest value of 91.74%, was observed in these functional food products. The content of polyphenolic compounds varied from 0.044 to 0.091 mg/g DW, while the content of total flavonoids varied from 0.03 to 0.66 mg/g DW. The processing method had an impact on the population of <i>L. plantarum</i> that survived, as indicated by the viability of bacterial cells in all the analyzed products. The chromatographic analysis through UHPLC-MS/MS further confirmed the abundance of the bioactive compounds and their corresponding derivatives by revealing 19 different compounds. The digestibility study indicated that carotenoid compounds from carrots followed a rather controlled release. The carrot-based products enriched with <i>Lactobacillus plantarum</i> can be considered newly functional developed products based on their high content of biologically active compounds with beneficial effects upon the human body. Furthermore, these types of products could represent innovative products for every related industry such as the food, pharmaceutical, and cosmeceutical industries, thus converging a new strategy to improve the health of consumers or patients.

Also flagged:Arthritisjoint diseasedegradationinflammationYes-associated proteintranscriptional coactivator
Journal Article 2024-02-19 No Snippets Li M, Zhang FJ, Bai RJ.
Show Full Abstract

Arthritis is the most prevalent joint disease and is characterized by articular cartilage degradation, synovial inflammation, and changes in periarticular and subchondral bone. Recent studies have reported that Yes-associated protein (YAP) and the transcriptional coactivator with PDZ-binding motif (TAZ) have significant effects on the proliferation, migration, and survival of chondrocytes and fibroblast-like synovial cells (FLSs). YAP/TAZ signaling pathway, as well as the related Hippo-YAP signaling pathway, are responsible for the condition of cells and articular cartilage in joints. They are tightly regulated to maintain metabolism in chondrocytes and FLSs because abnormal expression may result in cartilage damage. However, the roles and mechanisms of the Hippo-YAP pathway in arthritis remain largely unknown. This review summarizes the roles and key functions of YAP/TAZ and the Hippo-YAP signaling pathway in FLSs and chondrocytes for the induction of proliferation, migration, survival, and differentiation in rheumatoid arthritis (RA) and osteoarthritis (OA) research. We also discuss the therapeutic strategies involving YAP/TAZ and the related Hippo-YAP signaling pathway involved in OA.

Also flagged:glycerolphosphoethanolamineCellular senescencecell cyclelipidmetabolism
Journal Article 2024-02-19 No Snippets Tighanimine K, Nabuco Leva Ferreira Freitas JA, Nemazanyy I, Bankolé A, Benarroch-Popivker D, Brodesser S, Doré G, Robinson L, Benit P, Ladraa S, Saada YB, Friguet B, Bertolino P, Bernard D, Canaud G, Rustin P, Gilson E, Bischof O, Fumagalli S, Pende M.
Show Full Abstract

Cellular senescence affects many physiological and pathological processes and is characterized by durable cell cycle arrest, an inflammatory secretory phenotype and metabolic reprogramming. Here, by using dynamic transcriptome and metabolome profiling in human fibroblasts with different subtypes of senescence, we show that a homoeostatic switch that results in glycerol-3-phosphate (G3P) and phosphoethanolamine (pEtN) accumulation links lipid metabolism to the senescence gene expression programme. Mechanistically, p53-dependent glycerol kinase activation and post-translational inactivation of phosphate cytidylyltransferase 2, ethanolamine regulate this metabolic switch, which promotes triglyceride accumulation in lipid droplets and induces the senescence gene expression programme. Conversely, G3P phosphatase and ethanolamine-phosphate phospho-lyase-based scavenging of G3P and pEtN acts in a senomorphic way by reducing G3P and pEtN accumulation. Collectively, our study ties G3P and pEtN accumulation to controlling lipid droplet biogenesis and phospholipid flux in senescent cells, providing a potential therapeutic avenue for targeting senescence and related pathophysiology.

BTN2A2
Also flagged:Endoplasmic reticulumbreast cancercancerERSgene expressionMethotrexate
Journal Article 2024-02-19 ✓ 1 Snippet Yang B, Wang S, Yang Y, Li X, Yu F, Wang T.
In-Text Gene Mentions

…markers of macrophages,BTN2A2express on the…

Show Full Abstract

<h4>Background</h4>Breast cancer (BC) is a leading cause of mortality among women, underscoring the urgent need for improved therapeutic predictio. Developing a precise prognostic model is crucial. The role of Endoplasmic Reticulum Stress (ERS) in cancer suggests its potential as a critical factor in BC development and progression, highlighting the importance of precise prognostic models for tailored treatment strategies.<h4>Methods</h4>Through comprehensive analysis of ERS-related gene expression in BC, utilizing both single-cell and bulk sequencing data from varied BC subtypes, we identified eight key ERS-related genes. LASSO regression and machine learning techniques were employed to construct a prognostic model, validated across multiple datasets and compared with existing models for its predictive accuracy.<h4>Results</h4>The developed ERS-model categorizes BC patients into distinct risk groups with significant differences in clinical prognosis, confirmed by robust ROC, DCA, and KM analyses. The model forecasts survival rates with high precision, revealing distinct immune infiltration patterns and treatment responsiveness between risk groups. Notably, we discovered six druggable targets and validated Methotrexate and Gemcitabine as effective agents for high-risk BC treatment, based on their sensitivity profiles and potential for addressing the lack of active targets in BC.<h4>Conclusion</h4>Our study advances BC research by establishing a significant link between ERS and BC prognosis at both the molecular and cellular levels. By stratifying patients into risk-defined groups, we unveil disparities in immune cell infiltration and drug response, guiding personalized treatment. The identification of potential drug targets and therapeutic agents opens new avenues for targeted interventions, promising to enhance outcomes for high-risk BC patients and paving the way for personalized cancer therapy.

Also flagged:tumourHepatocellular carcinomacholangiocarcinomaliver cancertyrosine kinasePD-L1
Journal Article 2024-02-19 No Snippets Rakké YS, Buschow SI, IJzermans JNM, Sprengers D.
Show Full Abstract

Hepatocellular carcinoma (HCC) and cholangiocarcinoma (CCA) are the first and second most common primary liver cancer (PLC). For decades, systemic therapies consisting of tyrosine kinase inhibitors (TKIs) or chemotherapy have formed the cornerstone of treating advanced-stage HCC and CCA, respectively. More recently, immunotherapy using immune checkpoint inhibition (ICI) has shown anti-tumour reactivity in some patients. The combination regimen of anti-PD-L1 and anti-VEGF antibodies has been approved as new first-line treatment of advanced-stage HCC. Furthermore, gemcibatine plus cisplatin (GEMCIS) with an anti-PD-L1 antibody is awaiting global approval for the treatment of advanced-stage CCA. As effective anti-tumour reactivity using ICI is achieved in a minor subset of both HCC and CCA patients only, alternative immune strategies to sensitise the tumour microenvironment of PLC are waited for. Here we discuss immune checkpoint stimulation (ICS) as additional tool to enhance anti-tumour reactivity. Up-to-date information on the clinical application of ICS in onco-immunology is provided. This review provides a rationale of the application of next-generation ICS either alone or in combination regimen to potentially enhance anti-tumour reactivity in PLC patients.

PEBP1
Also flagged:DNA polymerasehepatocellular carcinomahemophilia Acapsidsynthesispolymerase
Journal Article 2024-02-19 ✓ 2 Snippets Zhang J, Yu X, Chrzanowski M, Tian J, Pouchnik D, Guo P, Herzog RW, Xiao W.
In-Text Gene Mentions

AAV induces hepatocellular carcinoma (HCC) in diabetic and obese mice dependent on the Pebp1 pathway.9

…dependent on thePebp1pathway.…

Show Full Abstract

The unique palindromic inverted terminal repeats (ITRs) and single-stranded nature of adeno-associated virus (AAV) DNA are major hurdles to current sequencing technologies. Due to these characteristics, sequencing noncanonical AAV genomes present in AAV vector preparations remains challenging. To address this limitation, we developed thorough molecule configuration analysis of noncanonical AAV genomes (TMCA-AAV-seq). TMCA-AAV-seq takes advantage of the documented AAV packaging mechanism in which encapsidation initiates from its 3' ITR, for AAV-seq library construction. Any AAV genome with a 3' ITR is converted to a template suitable to adapter addition by a Bst DNA polymerase-mediated extension reaction. This extension reaction helps fix ITR heterogeneity in the AAV population and allows efficient adapter addition to even noncanonical AAV genomes. The resulting library maintains the original AAV genome configurations without introducing undesired changes. Subsequently, long-read sequencing can be performed by the Pacific Biosciences (PacBio) single-molecule, real-time (SMRT) sequencing technology platform. Finally, through comprehensive data analysis, we can recover canonical, noncanonical AAV DNA, and non-AAV vector DNA sequences, along with their molecular configurations. Our method is a robust tool for profiling thorough AAV-population genomes. TMCA-AAVseq can be further extended to all parvoviruses and their derivative vectors.

Also flagged:COVID-19posttraumatic stress disorderPTSDcoronavirus disease 2019infectionCOVID-19 infection
Journal Article 2024-02-19 No Snippets Vo HT, Dao TD, Duong TV, Nguyen TT, Do BN, Do TX, Pham KM, Vu VH, Pham LV, Nguyen LTH, Le LTH, Nguyen HC, Dang NH, Nguyen TH, Nguyen AT, Nguyen HV, Nguyen PB, Nguyen HTT, Pham TTM, Le TT, Nguyen TTP, Tran CQ, Nguyen KT.
Show Full Abstract

<h4>Background</h4>The prevalence of posttraumatic stress disorder (PTSD) has increased, particularly among individuals who have recovered from coronavirus disease 2019 (COVID-19) infection. Health literacy is considered a "social vaccine" that helps people respond effectively to the pandemic. We aimed to investigate the association between long COVID-19 and PTSD, and to examine the modifying role of health literacy in this association.<h4>Methods</h4>A cross-sectional study was conducted at 18 hospitals and health centers in Vietnam from December 2021 to October 2022. We recruited 4,463 individuals who had recovered from COVID-19 infection for at least 4 weeks. Participants provided information about their sociodemographics, clinical parameters, health-related behaviors, health literacy (using the 12-item short-form health literacy scale), long COVID-19 symptoms and PTSD (Impact Event Scale-Revised score of 33 or higher). Logistic regression models were used to examine associations and interactions.<h4>Results</h4>Out of the study sample, 55.9% had long COVID-19 symptoms, and 49.6% had PTSD. Individuals with long COVID-19 symptoms had a higher likelihood of PTSD (odds ratio [OR], 1.86; 95% confidence interval [CI], 1.63-2.12; p<0.001). Higher health literacy was associated with a lower likelihood of PTSD (OR, 0.98; 95% CI, 0.97-0.99; p=0.001). Compared to those without long COVID-19 symptoms and the lowest health literacy score, those with long COVID-19 symptoms and a 1-point health literacy increment had a 3% lower likelihood of PTSD (OR, 0.97; 95% CI, 0.96-0.99; p=0.001).<h4>Conclusion</h4>Health literacy was found to be a protective factor against PTSD and modified the negative impact of long COVID-19 symptoms on PTSD.

Also flagged:biofilm formationwaterpolymerasetdhtrhceftazidime
Journal Article 2024-02-19 No Snippets Nguyen KCT, Truong PH, Thi HT, Ho XT, Nguyen PV.
Show Full Abstract

<h4>Background</h4>Vibrio parahaemolyticus is a major foodborne pathogen in aquatic animals and a threat to human health worldwide. This study investigated the prevalence, antimicrobial resistance, antimicrobial resistance genes (ARGs), and biofilm formation of V. parahaemolyticus strains isolated from fish mariculture environments in Cat Ba Island, Vietnam.<h4>Methods</h4>In total, 150 rearing water samples were collected from 10 fish mariculture farms in winter and summer. A polymerase chain reaction assay was used to identify V. parahaemolyticus, its virulence factors, and ARGs. The antimicrobial resistance patterns and biofilm formation ability of V. parahaemolyticus strains were investigated using the disk diffusion test and a microtiter plate-based crystal violet method, respectively.<h4>Results</h4>Thirty-seven V. parahaemolyticus isolates were recovered from 150 samples. The frequencies of the tdh and trh genes among V. parahaemolyticus isolates were 8.1% and 21.6%, respectively. More than 90% of isolates were susceptible to ceftazidime, cefotaxime, and chloramphenicol, but over 72% were resistant to ampicillin, tetracycline, and erythromycin. Furthermore, 67.57% of isolates exhibited multidrug resistance. The presence of ARGs related to gentamicin (aac(3)-IV), tetracycline (tetA) and ciprofloxacin (qnrA) in V. parahaemolyticus isolates was identified. Conversely, no ARGs related to ampicillin or erythromycin resistance were detected. Biofilm formation capacity was detected in significantly more multidrug-resistant isolates (64.9%) than non-multidrug-resistant isolates (18.9%).<h4>Conclusion</h4>Mariculture environments are a potential source of antibiotic-resistant V. parahaemolyticus and a hotspot for virulence genes and ARGs diffusing to aquatic environments. Thus, the prevention of antibiotic-resistant foodborne vibriosis in aquatic animals and humans requires continuous monitoring.

Also flagged:17-Beta-Hydroxysteroid DehydrogenaseNonalcoholic Fatty Liver DiseaseNAFLDPatatin-like phospholipase domain-containing 3lipidHSD17B13
Journal Article 2024-02-19 No Snippets Govardhan B, Anand VK, Nagaraja Rao P, Balachandran Menon P, Mithun S, Sasikala M, Sowmya TR, Anuradha S, Smita CP, Nageshwar Reddy D, Ravikanth V.
Show Full Abstract

<h4>Background</h4>A splice variant in <i>HSD17B13</i> gene is demonstrated to protect against nonalcoholic fatty liver disease (NAFLD), and mitigate the effect of Patatin-like phospholipase domain-containing 3 (<i>PNPLA3</i>-I148M). It is being explored as a putative drug target and in polygenic risk scores. Based on whole exome sequencing (WES) in our cohort of biopsy proven NAFLD and limited data on the variant in our ethnicity, we sought to explore its role.<h4>Methods</h4>This is a cross-sectional study that recruited 1,020 individuals with ultrasound/biopsy-confirmed NAFLD and matched controls. Liver enzymes and lipid profiles were estimated (Beckman coulter LX750/DXH800); WES was performed in NAFLD patients and controls (Illumina; HiSeqX); <i>HSD17B13</i>-A-INS/I148M-<i>PNPLA3</i> variants were genotyped (sequencing/qR T-PCR); HSD17B13 protein expression was estimated (immunohistochemistry); the Student's t-test/Mann-Whitney U/Chi-square test and odds ratio (95% confidence interval) were used.<h4>Results</h4>There was no significant difference (Odds ratio = 0.76; 95% CI -0.57 to 1.03; <i>P</i> = 0.76) in the frequency of the rs72613567-A-INS between controls and patients (17.8% vs. 14.4%). No difference in the ALT (Alanine transaminase; 72.24 ± 65.13 vs. 73.70 ± 60.06; <i>P</i> = 0.51) and AST levels (Aspartate aminotransferase; 60.72 ± 55.59 vs. 61.63 ± 60.33; <i>P</i> = 0.91) between <i>HSD17B13-</i>wild and variant carriers were noted. Significantly elevated liver enzymes were seen in <i>PNPLA3</i>-148-variant/<i>HSD17B13-</i>wild compared with <i>PNPLA3</i>-148-variant/<i>HSD17B13-</i>variant (90.44 ± 59.0 vs. 112.32 ± 61.78; <i>P</i> = 0.02). No difference in steatosis (<i>P</i> = 0.51) between <i>HSD17B13</i>-wild and variant carriers was noted. No other variants in the intron-exon boundaries were identified. Although, protein expression differences were noted between wild and variant carriers, no difference in the extent of steatosis was seen.<h4>Conclusion</h4>Our study reports lack of association of the splice variant with reduced risk of NAFLD, and mitigating the effect of <i>PNPLA3</i> variant. Ethnicity-based validation must be carried out before including it in assessing protection against NAFLD.

Also flagged:tissue homeostasisinfectioninfluenza infectionviral infectionPD-L1pulmonary edema
Journal Article 2024-02-19 No Snippets Ge J, Shao H, Ding H, Huang Y, Wu X, Sun J, Que J.
Show Full Abstract

Tissue lymphatic vessels network plays critical roles in immune surveillance and tissue homeostasis in response to pathogen invasion, but how lymphatic system <i>per se</i> is remolded during infection is less understood. Here, we observed that influenza infection induces a significant increase of lymphatic vessel numbers in the lung, accompanied with extensive proliferation of lymphatic endothelial cells (LECs). Single-cell RNA sequencing illustrated the heterogeneity of LECs, identifying a novel PD-L1<sup>+</sup> subpopulation that is present during viral infection but not at steady state. Specific deletion of <i>Pd-l1</i> in LECs elevated the expansion of lymphatic vessel numbers during viral infection. Together these findings elucidate a dramatic expansion of lung lymphatic network in response to viral infection, and reveal a PD-L1<sup>+</sup> LEC subpopulation that potentially modulates lymphatic vessel remolding.

Also flagged:diabetic kidney diseaseglucosepolymerasebindingphospholipase D-/B-cell receptors
Journal Article 2024-02-18 No Snippets Zhang Z, Qiao Y, Ji J, Huang C, Shi H, Gan W, Zhang A.
Show Full Abstract

The prevalence of diabetic kidney disease (DKD) is increasing annually. Damage to and loss of podocytes occur early in DKD. tRNA-derived fragments (tRFs), originating from tRNA precursors or mature tRNAs, are associated with various illnesses. In this study, tRFs were identified, and their roles in podocyte injury induced by high-glucose (HG) treatment were explored. High-throughput sequencing of podocytes treated with HG was performed to identify differentially expressed tRFs. Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) analyses were performed. The expression levels of nephrin, podocin, and desmin were measured in podocytes after overexpression of tRF-1:24-Glu-CTC-1-M2 (tRF-1:24) and concomitant HG treatment. A total of 647 tRFs were identified, and 89 differentially expressed tRFs (|log2FC| ≥ 0.585; <i>p</i> ≤ .05) were identified in the HG group, of which 53 tRFs were downregulated and 36 tRFs were upregulated. The 10 tRFs with the highest differential expression were detected by real-time quantitative polymerase chain reaction (RT-qPCR), and these results were consistent with the sequencing results. GO analysis revealed that the biological process, cellular component, and molecular function terms in which the tRFs were the most enriched were cellular processes, cellular anatomical entities, and binding. KEGG pathway analysis revealed that tRFs may be involved in signaling pathways related to growth hormones, phospholipase D, the regulation of stem cell pluripotency, and T-/B-cell receptors. Overexpression of tRF-1:24, one of the most differentially expressed tRFs, attenuated podocyte injury induced by HG. Thus, tRFs might be potential biomarkers for podocyte injury in DKD.

POU3F2
Also flagged:tricho-rhino phalangeal syndromeTrps1Wntembryogenesisgene expressionchromosome
Journal Article 2024-02-18 ✓ 1 Snippet Abrar M, Ali S, Hussain I, Khatoon H, Batool F, Ghazanfar S, Corcoran D, Kawakami Y, Abbasi AA.
In-Text Gene Mentions

Pou3f2

Show Full Abstract

TRPS1 serves as the causative gene for tricho-rhino phalangeal syndrome, known for its craniofacial and skeletal abnormalities. The Trps1 gene encodes a protein that represses Wnt signaling through strong interactions with Wnt signaling inhibitors. The identification of genomic cis-acting regulatory sequences governing Trps1 expression is crucial for understanding its role in embryogenesis. Nevertheless, to date, no investigations have been conducted concerning these aspects of Trps1. To identify deeply conserved noncoding elements (CNEs) within the Trps1 locus, we employed a comparative genomics approach, utilizing slowly evolving fish such as coelacanth and spotted gar. These analyses resulted in the identification of eight CNEs in the intronic region of the Trps1 gene. Functional characterization of these CNEs in zebrafish revealed their regulatory potential in various tissues, including pectoral fins, heart, and pharyngeal arches. RNA in-situ hybridization experiments revealed concordance between the reporter expression pattern induced by the identified set of CNEs and the spatial expression pattern of the trps1 gene in zebrafish. Comparative in vivo data from zebrafish and mice for CNE7/hs919 revealed conserved functions of these enhancers. Each of these eight CNEs was further investigated in cell line-based reporter assays, revealing their repressive potential. Taken together, in vivo and in vitro assays suggest a context-dependent dual functionality for the identified set of Trps1-associated CNE enhancers. This functionally characterized set of CNE-enhancers will contribute to a more comprehensive understanding of the developmental roles of Trps1 and can aid in the identification of noncoding DNA variants associated with human diseases.

Also flagged:Fibromyalgiachronic pain syndromegene expressionextracellularRhoGDItissue homeostasis
Journal Article 2024-02-17 No Snippets Mohapatra G, Dachet F, Coleman LJ, Gillis B, Behm FG.
Show Full Abstract

Fibromyalgia (FM) is a chronic pain syndrome characterized by widespread pain. The pathophysiology of fibromyalgia is not clearly understood and there are no specific biomarkers available for accurate diagnosis. Here we define genomic signatures using high throughput RNA sequencing on 96 fibromyalgia and 93 control cases. Our findings revealed three major fibromyalgia-associated expression signatures. The first group included 43 patients with a signature enriched for gene expression associated with extracellular matrix and downregulation of RhoGDI signaling pathway. The second group included 30 patients and showed a profound reduction in the expression of inflammatory mediators with an increased expression of genes involved in the CLEAR signaling pathway. These results suggest defective tissue homeostasis associated with the extra-cellular matrix and cellular program that regulates lysosomal biogenesis and participates in macromolecule clearance in fibromyalgia. The third group of 17 FM patients showed overexpression of pathways that control acute inflammation and dysfunction of the global transcriptional process. The result of this study indicates that FM is a heterogeneous and complex disease. Further elucidation of these pathways will lead to the development of accurate diagnostic markers, and effective therapeutic options for fibromyalgia.

Also flagged:collagenpathogenesisintestinal lipomaintestinal obstructionmalignant abdominal tumorstuberculous granuloma
Journal Article 2024-02-17 No Snippets Sang W, Li Y, Hong X, Qu H, Zhu R, Yi Q.
Show Full Abstract

Peritoneal loose body (PLB) is a kind of lesions located in the abdominal cavity or pelvic cavity, which is rare and difficult to diagnose. The diameter of PLB is mostly 0.5-2.5 cm. Most PLBS are asymptomatic. Here we reported a case of giant PLB in the pelvis and analyzed its structure and protein composition. Surgical exploration revealed a white oval mass (4.5*4*3 cm) in the pelvic cavity. After the mass was removed, the symptoms of hematuria disappeared and the patient was discharged on the second postoperative day. Histochemical staining showed that PLB was mainly composed of collagen and scattered calcification. The protein components of PLB were detected by proteome analysis, and a variety of proteins related to collagen deposition and calcification were identified in PLB.

Also flagged:Mitochondriaorganellesmitochondrialfertilizationautophagymembranous
Journal Article 2024-02-17 No Snippets Sasaki T, Kushida Y, Norizuki T, Kosako H, Sato K, Sato M.
Show Full Abstract

Allophagy is responsible for the selective removal of paternally inherited organelles, including mitochondria, in Caenorhabditis elegans embryos, thereby facilitating the maternal inheritance of mitochondrial DNA. We previously identified two key factors in allophagy: an autophagy adaptor allophagy-1 (ALLO-1) and TBK1/IKKε family kinase IKKE-1. However, the precise mechanisms by which ALLO-1 and IKKE-1 regulate local autophagosome formation remain unclear. In this study, we identify two ALLO-1 isoforms with different substrate preferences during allophagy. Live imaging reveals a stepwise mechanism of ALLO-1 localization with rapid cargo recognition, followed by ALLO-1 accumulation around the cargo. In the ikke-1 mutant, the accumulation of ALLO-1, and not the recognition of cargo, is impaired, resulting in the failure of isolation membrane formation. Our results also suggest a feedback mechanism for ALLO-1 accumulation via EPG-7/ATG-11, a worm homolog of FIP200, which is a candidate for IKKE-1-dependent phosphorylation. This feedback mechanism may underlie the ALLO-1-dependent initiation and progression of autophagosome formation around paternal organelles.

Also flagged:Cancertumorstumorcancersbreast cancerprostate cancer
Journal Article 2024-02-17 No Snippets Fedele M, Cerchia L, Battista S.
Show Full Abstract

The classification of tumors into subtypes, characterized by phenotypes determined by specific differentiation pathways, aids diagnosis and directs therapy towards targeted approaches. However, with the advent and explosion of next-generation sequencing, cancer phenotypes are turning out to be far more heterogenous than initially thought, and the classification is continually being updated to include more subtypes. Tumors are indeed highly dynamic, and they can evolve and undergo various changes in their characteristics during disease progression. The picture becomes even more complex when the tumor responds to a therapy. In all these cases, cancer cells acquire the ability to transdifferentiate, changing subtype, and adapt to changing microenvironments. These modifications affect the tumor's growth rate, invasiveness, response to treatment, and overall clinical behavior. Studying tumor subtype transitions is crucial for understanding tumor evolution, predicting disease outcomes, and developing personalized treatment strategies. We discuss this emerging hallmark of cancer and the molecular mechanisms involved at the crossroads between tumor cells and their microenvironment, focusing on four different human cancers in which tissue plasticity causes a subtype switch: breast cancer, prostate cancer, glioblastoma, and pancreatic adenocarcinoma.

DCC
Also flagged:Transcription Factorsdevelopmental delayautism spectrum disorderintellectual disabilityIDattention-deficit/hyperactivity disorder
Journal Article 2024-02-17 ✓ 1 Snippet Seigfried FA, Britsch S.
In-Text Gene Mentions

Early studies showed that knockdown of Bcl11a in cultured neurons increased axon branching, multi-axon formation, and dendrite outgrowth, which could be rescued by the overexpression of deleted in colorectal carcinoma (Dcc) and microtubule-associated protein 1b (Map1b) [52].

Show Full Abstract

Neurodevelopmental disorders (NDDs) comprise a diverse group of diseases, including developmental delay, autism spectrum disorder (ASD), intellectual disability (ID), and attention-deficit/hyperactivity disorder (ADHD). NDDs are caused by aberrant brain development due to genetic and environmental factors. To establish specific and curative therapeutic approaches, it is indispensable to gain precise mechanistic insight into the cellular and molecular pathogenesis of NDDs. Mutations of <i>BCL11A</i> and <i>BCL11B</i>, two closely related, ultra-conserved zinc-finger transcription factors, were recently reported to be associated with NDDs, including developmental delay, ASD, and ID, as well as morphogenic defects such as cerebellar hypoplasia. In mice, Bcl11 transcription factors are well known to orchestrate various cellular processes during brain development, for example, neural progenitor cell proliferation, neuronal migration, and the differentiation as well as integration of neurons into functional circuits. Developmental defects observed in both, mice and humans display striking similarities, suggesting Bcl11 knockout mice provide excellent models for analyzing human disease. This review offers a comprehensive overview of the cellular and molecular functions of Bcl11a and b and links experimental research to the corresponding NDDs observed in humans. Moreover, it outlines trajectories for future translational research that may help to better understand the molecular basis of Bcl11-dependent NDDs as well as to conceive disease-specific therapeutic approaches.

HTT
Also flagged:Transglutaminasespost-translational modificationpeptidesglutamineglutamyllysine
Journal Article 2024-02-17 ✓ 2 Snippets Liu J, Mouradian MM.
In-Text Gene Mentions

As a consequence, the mutated protein HTT (mHTT) contains disease-causing expansions of glutamines that make it prone to misfold and aggregate [154].

In humans, the HTT gene normally contains between 6 and 35 CAG repeats, whereas HD is caused by a mutation in the IT-15 gene that expands a highly polymorphic CAG tract with greater than 39 repeats [153].

Show Full Abstract

Neurodegenerative diseases encompass a heterogeneous group of disorders that afflict millions of people worldwide. Characteristic protein aggregates are histopathological hallmark features of these disorders, including Amyloid β (Aβ)-containing plaques and tau-containing neurofibrillary tangles in Alzheimer's disease, α-Synuclein (α-Syn)-containing Lewy bodies and Lewy neurites in Parkinson's disease and dementia with Lewy bodies, and mutant huntingtin (mHTT) in nuclear inclusions in Huntington's disease. These various aggregates are found in specific brain regions that are impacted by neurodegeneration and associated with clinical manifestations. Transglutaminase (TG2) (also known as tissue transglutaminase) is the most ubiquitously expressed member of the transglutaminase family with protein crosslinking activity. To date, Aβ, tau, α-Syn, and mHTT have been determined to be substrates of TG2, leading to their aggregation and implicating the involvement of TG2 in several pathophysiological events in neurodegenerative disorders. In this review, we summarize the biochemistry and physiologic functions of TG2 and describe recent advances in the pathogenetic role of TG2 in these diseases. We also review TG2 inhibitors tested in clinical trials and discuss recent TG2-targeting approaches, which offer new perspectives for the design of future highly potent and selective drugs with improved brain delivery as a disease-modifying treatment for neurodegenerative disorders.

MLLT10
Also flagged:KCNJ15reproductionpotassium inward rectifying channelpotassium channelvoltage valve ion channelpotassium
Journal Article 2024-02-17 ✓ 1 Snippet Zhao J, Liu Z, Wang X, Xin X, Du L, Zhao H, An Q, Ding X, Zhang Z, Wang E, Xu Z, Huang Y.
In-Text Gene Mentions

…CNV of theMLLT10gene exerted a…

Show Full Abstract

(1) Background: Copy number variation (CNV) is a critical component of genome structural variation and has garnered significant attention. High-throughput screening of the <i>KCNJ15</i> gene has revealed a correlation between the CNV region and the growth traits of goats. We aimed to identify the CNV of the <i>KCNJ15</i> gene in five goat breeds and analyze its association with growth characteristics. (2) Methods: We utilized 706 goats from five breeds: Guizhou black goat (GZB), Guizhou white goat (GZW), Bohuai goat (BH), Huai goat (HH), and Taihang goat (TH). To evaluate the number of copies of the <i>KCNJ15</i> gene using qPCR, we analyzed the correlation between the CNV and growth characteristics and then used a universal linear model. The findings revealed variations in the distribution of different copy number types among the different goat breeds. (3) Results: Association analysis revealed a positive influence of the CNV in the <i>KCNJ15</i> gene on goat growth. In GZB, individuals with duplication types exhibited superior performance in terms of cannon bone circumference (<i>p</i> < 0.05). In HH, individuals with duplication types exhibited superior performance in terms of body slanting length (<i>p</i> < 0.05). Conversely, normal TH demonstrated better body height and body weight (<i>p</i> < 0.05), while in GZW, when CN = 3, it performed better than other types in terms of body weight and chest circumference (<i>p</i> < 0.05). However, in BH, it had no significant effect on growth traits. (4) Conclusions: We confirmed that the CNV in the <i>KCNJ15</i> gene significantly influences the growth characteristics of four distinct goat breeds. The correlation between <i>KCNJ15</i> gene CNVs and goat growth traits offers valuable insights to breeders, enabling them to employ precise and efficient breeding methods that enhance livestock welfare, productivity, and overall economic benefits in the industry.

Also flagged:Schiff basesanilineSynthesiscinnamaldehydeCA8Schiff base
Journal Article 2024-02-17 No Snippets Waziri I, Kelani MT, Oyedeji-Amusa MO, Oyebamiji AK, Coetzee LC, Muller AJ.
Show Full Abstract

Bacterial resistance to antibiotics poses a significant global challenge for the public sector. Globally, researchers are actively investigating solutions to tackle the issue of bacterial resistance to antibiotics, with Schiff bases standing out as promising contenders in the fight against antimicrobial resistance. This study focused on synthesizing a series of Schiff bases (<b>CA1</b>-<b>CA10</b>) by reacting cinnamaldehyde with various aniline derivatives. Various analytical techniques, such as NMR, FTIR, UV-Vis, elemental analysis, and mass spectrometry, were employed to elucidate the structures of the synthesized compounds. Furthermore, crystal structure of <b>CA8</b> was obtained using single crystal X-ray spectroscopy. The compounds were subjected to <i>in vitro</i> testing to assess their antibacterial and antifungal properties against eleven bacterial strains and four fungal strains. The results revealed diverse activity levels against the pathogens at varying concentrations, with notable potency observed in compounds <b>CA3</b>, <b>CA4</b>, <b>CA9</b>, and <b>CA10</b>, as indicated by their minimum inhibitory concentrations (MIC) values. The observed activity of the compounds seemed to be influenced by the specific substituents attached to their molecular structure. By conducting computational and molecular docking studies, the electronic properties of the compounds were investigated, further substantiating their potential as effective antimicrobial agents.

HTT
Also flagged:nuclear importHuntington's/Huntington's diseaseHuntingtincell cyclenuclear pore
Journal Article 2024-02-17 ✓ 2 Snippets Dubey SK, Lloyd TE, Tapadia MG.
In-Text Gene Mentions

…levels of huntingtin (htt) transcripts throughout the…

…model, expressing mutantHTTwith ∼190 CAG…

Show Full Abstract

Huntington's disease is caused by an expansion of CAG repeats in exon 1 of the huntingtin gene encoding an extended PolyQ tract within the Huntingtin protein (mHtt). This expansion results in selective degeneration of striatal medium spiny projection neurons in the basal ganglia. The mutation causes abnormalities during neurodevelopment in human and mouse models. Here, we report that mHtt/PolyQ aggregates inhibit the cell cycle in the Drosophila brain during development. PolyQ aggregates disrupt the nuclear pore complexes of the cells preventing the translocation of cell cycle proteins such as Cyclin E, E2F and PCNA from cytoplasm to the nucleus, thus affecting cell cycle progression. PolyQ aggregates also disrupt the nuclear pore complex and nuclear import in mHtt expressing mammalian CAD neurons. PolyQ toxicity and cell cycle defects can be restored by enhancing RanGAP-mediated nuclear import, suggesting a potential therapeutic approach for this disease.

Also flagged:hydroxyapatitechitosanpore wallsPeriostintumorbone resorption
Journal Article 2024-02-17 No Snippets Wang H, Sun R, Huang S, Wu H, Zhang D.
Show Full Abstract

This paper reports a facile fabrication method of hydroxyapatite/chitosan (HAp/CS) composite scaffold with 3D porous structure without using any chemical cross-linkers. The HAp particles had an urchin-like hollow microstructure and high surface area, which was uniformly dispersed into the pore walls of the HAp/CS scaffold. The addition of HAp can efficiently enhance the mechanical properties and bioactivity of the HAp/CS scaffold. Moreover, periostin was successfully loaded onto the HAp/CS scaffold. When applied to the repair of bone defect in a rat mandibular model, the HAp/CS scaffold loaded with periostin can enhance osteointegration and accelerate bone regeneration. Our research combines periostin with the HAp/CS composite material, which provides a novel strategy to improve bone regeneration and has great application prospect in bone repair fields.

medRxiv 2024-02-17 Preprint (No Snippets API) Mountford HS, Eising E, Fontanillas P, Auton A, 23andMe Research Team, Irving-Pease EK, Doust C, Bates TC, Martin NG, Fisher SE, Luciano M.
Show Full Abstract

The ability to read is an important life skill and a major route to education. Individual differences in reading ability are influenced by genetic variation, with a heritability of 0.66 for word reading, estimated by twin studies. Until recently, genomic investigations were limited by modest sample size. Here we use a multivariate genome-wide association study (GWAS) method, MTAG, to leverage summary statistics from two independent GWAS efforts, boosting power for analyses of reading ability; GenLang meta-analysis of word reading (N = 27 180) and the 23andMe, Inc., study of dyslexia (N cases = 51 800, N controls = 1 087 070). We increase effective sample size to N = 102 082, representing the largest genetic study of reading ability, to date. We identified 35 independent genome-wide significant loci, including 7 regions not previously reported. Single-nucleotide polymorphism (SNP) based heritability was estimated at 24%. We observed clear positive genetic correlations with cognitive and educational measures. Gene-set analyses implicated neuronal synapses and proneural glioblastoma pathways, further supported by enrichment of neuronally expressed genes in the developing embryonic brain. Polygenic scores of our multivariate results predicted between 2.29-3.50% of variance in reading ability in an independent sample, the National Child Development Study cohort (N = 6 410). Polygenic adaptation was examined using a large panel of ancient genomes spanning the last ∼15k years. We did not find evidence of selection, suggesting that reading ability may not have been subject to recent selection pressure in Europeans. By combining existing datasets to improve statistical power, these results provide novel insights into the biology of reading.

medRxiv 2024-02-17 Preprint (No Snippets API) Dardani C, Robinson JW, Jones HJ, Rai D, Stergiakouli E, Grove J, Gardner R, McIntosh AM, Havdahl A, Hemani G, Davey Smith G, Richardson TG, Gaunt TR, Khandaker GM.
Show Full Abstract

Immune dysfunction is implicated in the aetiology of psychiatric, neurodevelopmental, and neurodegenerative conditions, but the issue of causality remains unclear, impeding attempts to develop new interventions. Using genomic data on protein and gene expression across blood and brain, we assessed evidence of a potential causal role for 736 immune response-related biomarkers on 7 neuropsychiatric conditions by applying Mendelian randomization (MR) and genetic colocalisation analyses. A systematic three-tier approach, grouping biomarkers based on increasingly stringent criteria, was used to appraise evidence of causality (passing MR sensitivity analyses, colocalisation, False Discovery Rate and Bonferroni thresholds). We provide evidence for a potential causal role of 29 biomarkers for 7 conditions. The identified biomarkers suggest a role of both brain specific and systemic immune response in the aetiology of schizophrenia, Alzheimers disease, depression, and bipolar disorder. Of the identified biomarkers, 20 appeared to be therapeutically tractable, including ACE , TNFRSF17 , SERPING1 , AGER and CD40, with drugs approved or in advanced clinical trials. Based on the largest available selection of plasma immune-response related biomarkers, our study provides insight into possible influential biomarkers for the aetiology of neuropsychiatric conditions. These genetically prioritised biomarkers now require further examination to evaluate causality, their role in the aetiological mechanisms underlying the conditions and therapeutic potential.

bioRxiv 2024-02-17 Preprint (No Snippets API) Murphy AE, Beardall W, Rei M, Phuycharoen M, Skene NG.
Show Full Abstract

Understanding genetic variants effects on the epigenome is crucial for interpreting genome-wide association studies (GWAS) results, yet profiling these effects across the non-coding genome remains challenging due to the scalability limits of experimental methods. This necessitates accurate computational models. Existing machine learning approaches, while progressively improving, are confined to the cell types they were trained on, limiting their applicability. Here, we propose the development of a deep learning model, Enformer Celltyping, which can both incorporate distal effects of DNA interactions, up to 100,000 base-pairs away, and predict epigenetic signals in a cell type-agnostic fashion. We demonstrate that Enformer Celltypings predictions of the epigenome out-perform the current best-in-class approach, have strong performance in a range of different cell types and biological regions and generalise to cell types assayed independently of the original training set. Finally, we propose an approach to test epigenetic models performance on genetic variant effect predictions using regulatory quantitative trait loci mapping studies, highlighting Enformer Celltypings and other genomic deep learning models limitations for this task. Our work introduces a new, accurate model for cell type-agnostic histone mark predictions and highlights the benefit of transfer learning for more efficient model development for deep learning in genomics. We make our customisable and efficient transfer learning approach for Enformer available to the community.

HTT
Also flagged:agingneurodegenerative diseasesamino acidscholesterolmetabolismbile acids
Journal Article 2024-02-16 ✓ 1 Snippet Loh JS, Mak WQ, Tan LKS, Ng CX, Chan HH, Yeow SH, Foo JB, Ong YS, How CW, Khaw KY.
In-Text Gene Mentions

HD is an autosomal dominant neurodegenerative disease caused by a CAG repeat expansion in the huntingtin (HTT) gene.

Show Full Abstract

The human gastrointestinal tract is populated with a diverse microbial community. The vast genetic and metabolic potential of the gut microbiome underpins its ubiquity in nearly every aspect of human biology, including health maintenance, development, aging, and disease. The advent of new sequencing technologies and culture-independent methods has allowed researchers to move beyond correlative studies toward mechanistic explorations to shed light on microbiome-host interactions. Evidence has unveiled the bidirectional communication between the gut microbiome and the central nervous system, referred to as the "microbiota-gut-brain axis". The microbiota-gut-brain axis represents an important regulator of glial functions, making it an actionable target to ameliorate the development and progression of neurodegenerative diseases. In this review, we discuss the mechanisms of the microbiota-gut-brain axis in neurodegenerative diseases. As the gut microbiome provides essential cues to microglia, astrocytes, and oligodendrocytes, we examine the communications between gut microbiota and these glial cells during healthy states and neurodegenerative diseases. Subsequently, we discuss the mechanisms of the microbiota-gut-brain axis in neurodegenerative diseases using a metabolite-centric approach, while also examining the role of gut microbiota-related neurotransmitters and gut hormones. Next, we examine the potential of targeting the intestinal barrier, blood-brain barrier, meninges, and peripheral immune system to counteract glial dysfunction in neurodegeneration. Finally, we conclude by assessing the pre-clinical and clinical evidence of probiotics, prebiotics, and fecal microbiota transplantation in neurodegenerative diseases. A thorough comprehension of the microbiota-gut-brain axis will foster the development of effective therapeutic interventions for the management of neurodegenerative diseases.

DARS2
Also flagged:FARS2Cardiomyopathyheart diseasesarcomericmitochondrial phenylalanyl-tRNA synthetasemitochondrial aminoacyl-tRNA synthetase
Journal Article 2024-02-16 ✓ 3 Snippets Li B, Liu F, Chen X, Chen T, Zhang J, Liu Y, Yao Y, Hu W, Zhang M, Wang B, Liu L, Chen K, Wu Y.
In-Text Gene Mentions

In murine studies, heart-specific loss of Dars2 causes cardiac hypertrophy.35 Chemical random mutagenesis in WARS2V117L causes sensorineural hearing loss and HCM in mice.36 However, studies of DARS2 and WARS2 showed no direct clinical evidence for humans.11,13 Here, we demonstrated that another member of mtARS, FARS2, is a novel pathogenic gene in HCM.

…heart-specific loss ofDars2causes cardiac hypertrophy.…

…However, studies ofDARS2and WARS2 showed…

Show Full Abstract

<h4>Background</h4>Hypertrophic cardiomyopathy (HCM) is a common heritable heart disease. Although HCM has been reported to be associated with many variants of genes involved in sarcomeric protein biomechanics, pathogenic genes have not been identified in patients with partial HCM. FARS2 (the mitochondrial phenylalanyl-tRNA synthetase), a type of mitochondrial aminoacyl-tRNA synthetase, plays a role in the mitochondrial translation machinery. Several variants of <i>FARS2</i> have been suggested to cause neurological disorders; however, FARS2-associated diseases involving other organs have not been reported. We identified <i>FARS2</i> as a potential novel pathogenic gene in cardiomyopathy and investigated its effects on mitochondrial homeostasis and the cardiomyopathy phenotype.<h4>Methods</h4><i>FARS2</i> variants in patients with HCM were identified using whole-exome sequencing, Sanger sequencing, molecular docking analyses, and cell model investigation. <i>Fars2</i> conditional mutant (p.R415L) or knockout mice, <i>fars2</i>-knockdown zebrafish, and <i>Fars2</i>-knockdown neonatal rat ventricular myocytes were engineered to construct FARS2 deficiency models both in vivo and in vitro. The effects of FARS2 and its role in mitochondrial homeostasis were subsequently evaluated using RNA sequencing and mitochondrial functional analyses. Myocardial tissues from patients were used for further verification.<h4>Results</h4>We identified 7 unreported <i>FARS2</i> variants in patients with HCM. Heart-specific <i>Fars2</i>-deficient mice presented cardiac hypertrophy, left ventricular dilation, progressive heart failure accompanied by myocardial and mitochondrial dysfunction, and a short life span. Heterozygous cardiac-specific <i>Fars2</i><sup><i>R415L</i></sup> mice displayed a tendency to cardiac hypertrophy at age 4 weeks, accompanied by myocardial dysfunction. In addition, <i>fars2</i>-knockdown zebrafish presented pericardial edema and heart failure. FARS2 deficiency impaired mitochondrial homeostasis by directly blocking the aminoacylation of mt-tRNA<sup>Phe</sup> and inhibiting the synthesis of mitochondrial proteins, ultimately contributing to an imbalanced mitochondrial quality control system by accelerating mitochondrial hyperfragmentation and disrupting mitochondrion-related autophagy. Interfering with the mitochondrial quality control system using adeno-associated virus 9 or specific inhibitors mitigated the cardiac and mitochondrial dysfunction triggered by FARS2 deficiency by restoring mitochondrial homeostasis.<h4>Conclusions</h4>Our findings unveil the previously unrecognized role of <i>FARS2</i> in heart and mitochondrial homeostasis. This study may provide new insights into the molecular diagnosis and prevention of heritable cardiomyopathy as well as therapeutic options for FARS2-associated cardiomyopathy.

Also flagged:obesitysucrosegene expressionmethylationcardiomyopathyto
Journal Article 2024-02-16 No Snippets Croft AJ, Kelly C, Chen D, Haw TJ, Balachandran L, Murtha LA, Boyle AJ, Sverdlov AL, Ngo DTM.
Show Full Abstract

Sex-based differences in the development of obesity-induced cardiometabolic dysfunction are well documented, however, the specific mechanisms are not completely understood. Obesity has been linked to dysregulation of the epitranscriptome, but the role of N<sup>6</sup>-methyladenosine (m6A) RNA methylation has not been investigated in relation to the sex differences during obesity-induced cardiac dysfunction. In the current study, male and female C57BL/6J mice were subjected to short- and long-term high-fat/high-sucrose (HFHS) diet to induce obesogenic stress. Cardiac echocardiography showed males developed systolic and diastolic dysfunction after 4 mo of diet, but females maintained normal cardiac function despite both sexes being metabolically dysfunctional. Cardiac m6A machinery gene expression was differentially regulated by duration of HFHS diet in male, but not female mice, and left ventricular ejection fraction correlated with RNA machinery gene levels in a sex- and age-dependent manner. RNA-sequencing of cardiac transcriptome revealed that females, but not males may undergo protective cardiac remodeling early in the course of obesogenic stress. Taken together, our study demonstrates for the first time that cardiac RNA methylation machinery genes are regulated early during obesogenic stress in a sex-dependent manner and may play a role in the sex differences observed in cardiometabolic dysfunction.<b>NEW & NOTEWORTHY</b> Sex differences in obesity-associated cardiomyopathy are well documented but incompletely understood. We show for the first time that RNA methylation machinery genes may be regulated in response to obesogenic diet in a sex- and age-dependent manner and levels may correspond to cardiac systolic function. Our cardiac RNA-seq analysis suggests female, but not male mice may be protected from cardiac dysfunction by a protective cardiac remodeling response early during obesogenic stress.

PTGIS
Also flagged:endoplasmic reticulumtumorcell growthcancerslung squamous cell carcinomaLUSC
Journal Article 2024-02-16 ✓ 5 Snippets Wang R, Huang Y, He J, Jin S, Li X, Tan K, Xia W.
In-Text Gene Mentions

PTGIS and PLAAT1 might serve as new therapeutic targets for LUSC as well as biomarkers for prognosis and tumor immunity [40].

Among these model genes (FLNC, KLK6, PTGIS, PLAAT1 and GLYATL2), FLNC is an actin-binding protein that regulates the actin cytoskeleton in cells and is involved in cancer metastasis.

…PLAAT1 + 0.1427*ExpressionPTGIS.…

…of FLNC andPTGISexpression may lead…

…, KLK6 ,PTGIS, PLAAT1 and…

Show Full Abstract

<h4>Background</h4>Endoplasmic reticulum stress (ERS) acts critical roles on cell growth, proliferation, and metastasis in various cancers. However, the relationship between ERs and lung squamous cell carcinoma (LUSC) prognoses still remains unclear.<h4>Methods</h4>The consensus clustering analysis of ERS-related genes and the differential expression analysis between clusters were investigated in LUSC based on TCGA database. Furthermore, ERS-related prognostic risk models were constructed by LASSO regression and Cox regression analyses. Then, the predictive effect of the risk model was evaluated by Kaplan-Meier, Cox regression, and ROC Curve analyses, as well as validated in the GEO cohort. According to the optimal threshold, patients with LUSC were divided into high- and low- risk groups, and somatic mutations, immune cell infiltration, chemotherapy response and immunotherapy effect were systematically analyzed.<h4>Results</h4>Two ERS-related clusters were identified in patients with LUSC that had distinct patterns of immune cell infiltration. A 5-genes ERS-related prognostic risk model and nomogram were constructed and validated. Kaplan-Meier curves and Cox regression analysis showed that ERS risk score was an independent prognostic factor (p < 0.001, HR = 1.317, 95% CI = 1.159-1.496). Patients with low-risk scores presented significantly lower TIDE scores and significantly lower IC50 values for common chemotherapy drugs such as cisplatin and gemcitabine.<h4>Conclusion</h4>ERS-related risk signature has certain prognostic value and may be a potential therapeutic target and prognostic biomarker for LUSC patients.

ZNFX1
Also flagged:IFN-γ1bMSMDIFN-γIFNGmycobacterial diseaseinfectious diseases
Journal Article 2024-02-16 ✓ 4 Snippets Rosain J, Kiykim A, Michev A, Kendir-Demirkol Y, Rinchai D, Peel JN, Li H, Ocak S, Ozdemir PG, Le Voyer T, Philippot Q, Khan T, Neehus AL, Migaud M, Soudée C, Boisson-Dupuis S, Marr N, Borghesi A, Casanova JL, Bustamante J.
In-Text Gene Mentions

Since the recognition of MSMD 25 years ago, variants of 22 genes have been implicated in this condition (CCR2, CYBB, IFNG, IFNGR1, IFNGR2, IL12B, IL12RB1, IL12RB2, IL23R, IRF1, IRF8, ISG15, JAK1, MCTS1, NEMO, RORC, SPPL2A, STAT1, TBX21, TYK2, USP18, and ZNFX1) [1–9].

ZNFX1 is the only exception, and the mechanistic connection between this gene and MSMD remains unclear [3].

…USP18 , andZNFX1) [ 1…

ZNFX1is the only…

Show Full Abstract

<h4>Purpose</h4>Inborn errors of IFN-γ immunity underlie Mendelian susceptibility to mycobacterial disease (MSMD). Twenty-two genes with products involved in the production of, or response to, IFN-γ and variants of which underlie MSMD have been identified. However, pathogenic variants of IFNG encoding a defective IFN-γ have been described in only two siblings, who both underwent hematopoietic stem cell transplantation (HCST).<h4>Methods</h4>We characterized a new patient with MSMD by genetic, immunological, and clinical means. Therapeutic decisions were taken on the basis of these findings.<h4>Results</h4>The patient was born to consanguineous Turkish parents and developed bacillus Calmette-Guérin (BCG) disease following vaccination at birth. Whole-exome sequencing revealed a homozygous private IFNG variant (c.224 T > C, p.F75S). Upon overexpression in recipient cells or constitutive expression in the patient's cells, the mutant IFN-γ was produced within the cells but was not correctly folded or secreted. The patient was treated for 6 months with two or three antimycobacterial drugs only and then for 30 months with subcutaneous recombinant IFN-γ1b plus two antimycobacterial drugs. Treatment with IFN-γ1b finally normalized all biological parameters. The patient presented no recurrence of mycobacterial disease or other related infectious diseases. The treatment was well tolerated, without the production of detectable autoantibodies against IFN-γ.<h4>Conclusion</h4>We describe a patient with a new form of autosomal recessive IFN-γ deficiency, with intracellular, but not extracellular IFN-γ. IFN-γ1b treatment appears to have been beneficial in this patient, with no recurrence of mycobacterial infection over a period of more than 30 months. This targeted treatment provides an alternative to HCST in patients with complete IFN-γ deficiency or at least an option to better control mycobacterial infection prior to HCST.

HFE
Also flagged:metalsmanganesechromiumcopperaggressionanxiety
Journal Article 2024-02-16 ✓ 2 Snippets Schildroth S, Kordas K, White RF, Friedman A, Placidi D, Smith D, Lucchini RG, Wright RO, Horton M, Claus Henn B.
In-Text Gene Mentions

…children with thehemochromatosis(HFE) gene mutation.…

…with the hemochromatosis (HFE) gene mutation.…

Show Full Abstract

<h4>Background</h4>Exposure to environmental metals has been consistently associated with attention and behavioral deficits in children, and these associations may be modified by coexposure to other metals or iron (Fe) status. However, few studies have investigated Fe status as a modifier of a metal mixture, particularly with respect to attention-related behaviors.<h4>Methods</h4>We used cross-sectional data from the Public Health Impact of Metals Exposure study, which included 707 adolescents (10-14 years of age) from Brescia, Italy. Manganese, chromium, and copper were quantified in hair samples, and lead was quantified in whole blood, using inductively coupled plasma mass spectrometry. Concentrations of Fe status markers (ferritin, hemoglobin, transferrin) were measured using immunoassays or luminescence assays. Attention-related behaviors were assessed using the Conners Rating Scales Self-Report Scale-Long Form, Parent Rating Scales Revised-Short Form, and Teacher Rating Scales Revised-Short Form. We employed Bayesian kernel machine regression to examine associations of the metal mixture with these outcomes and evaluate Fe status as a modifier.<h4>Results</h4>Higher concentrations of the metals and ferritin were jointly associated with worse self-reported attention-related behaviors: metals and ferritin set to their 90th percentiles were associated with 3.0% [β=0.03; 95% credible interval (CrI): -0.01, 0.06], 4.1% (β=0.04; 95% CrI: 0.00, 0.08), and 4.1% (β=0.04; 95% CrI: 0.00, 0.08) higher T-scores for self-reported attention deficit/hyperactivity disorder (ADHD) index, inattention, and hyperactivity, respectively, compared with when metals and ferritin were set to their 50th percentiles. These associations were driven by hair manganese, which exhibited nonlinear associations with all self-reported scales. There was no evidence that Fe status modified the neurotoxicity of the metal mixture. The metal mixture was not materially associated with any parent-reported or teacher-reported scale.<h4>Conclusions</h4>The overall metal mixture, driven by manganese, was adversely associated with self-reported attention-related behavior. These findings suggest that exposure to multiple environmental metals impacts adolescent neurodevelopment, which has significant public health implications. https://doi.org/10.1289/EHP12988.

RC3H1
Also flagged:immune responsesomatic hypermutationswitchautoantibodiesautoantibodyFH
Journal Article 2024-02-16 ✓ 1 Snippet Akama-Garren EH, Yin X, Prestwood TR, Ma M, Utz PJ, Carroll MC.
In-Text Gene Mentions

Roquin-1

Show Full Abstract

T cell help is a crucial component of the normal humoral immune response, yet whether it promotes or restrains autoreactive B cell responses remains unclear. Here, we observe that autoreactive germinal centers require T cell help for their formation and persistence. Using retrogenic chimeras transduced with candidate TCRs, we demonstrate that a follicular T cell repertoire restricted to a single autoreactive TCR, but not a foreign antigen-specific TCR, is sufficient to initiate autoreactive germinal centers. Follicular T cell specificity influences the breadth of epitope spreading by regulating wild-type B cell entry into autoreactive germinal centers. These results demonstrate that TCR-dependent T cell help can promote loss of B cell tolerance and that epitope spreading is determined by TCR specificity.

DCC
Also flagged:axonscell proliferationcancerinsulin resistanceDeleted incolorectal cancer
Journal Article 2024-02-16 ✓ 5 Snippets Priest JM, Nichols EL, Smock RG, Hopkins JB, Mendoza JL, Meijers R, Shen K, Özkan E.
In-Text Gene Mentions

Finci et al. (10) have also observed putative sulfate ions in the human netrin-1–DCC crystal structure at the second EGF domain and proposed the positively charged surface on the EGF2 domain as a potential heparin-binding site.

…in colorectal cancer (DCC)/neogenin class of receptors…

…or clustering ofDCCor neogenin through…

…motifs conserved inDCC/neogenin cytoplasmic domains …

…defective netrin- andDCC-mediated axon guidance in…

Show Full Abstract

Netrins dictate attractive and repulsive responses during axon growth and cell migration, where the presence of the receptor Uncoordinated-5 (UNC-5) on target cells results in repulsion. Here, we showed that UNC-5 is a heparin-binding protein, determined its structure bound to a heparin fragment, and could modulate UNC-5-heparin affinity using a directed evolution platform or structure-based rational design. We demonstrated that UNC-5 and UNC-6/netrin form a large, stable, and rigid complex in the presence of heparin, and heparin and UNC-5 exclude the attractive UNC-40/DCC receptor from binding to UNC-6/netrin to a large extent. <i>Caenorhabditis elegans</i> with a heparin-binding-deficient UNC-5 fail to establish proper gonad morphology due to abrogated cell migration, which relies on repulsive UNC-5 signaling in response to UNC-6. Combining UNC-5 mutations targeting heparin and UNC-6/netrin contacts results in complete cell migration and axon guidance defects. Our findings establish repulsive netrin responses to be mediated through a glycosaminoglycan-regulated macromolecular complex.

Also flagged:viral infections-CoV-2 infectionCOVID-19respiratory illnesseslocalizationtranscription factors
Journal Article 2024-02-16 No Snippets Kole A, Bag AK, Pal AJ, De D.
Show Full Abstract

<h4>Purpose</h4>Graph coloring approach has emerged as a valuable problem-solving tool for both theoretical and practical aspects across various scientific disciplines, including biology. In this study, we demonstrate the graph coloring's effectiveness in computational network biology, more precisely in analyzing protein-protein interaction (PPI) networks to gain insights about the viral infections and its consequences on human health. Accordingly, we propose a generic model that can highlight important hub proteins of virus-associated disease manifestations, changes in disease-associated biological pathways, potential drug targets and respective drugs. We test our model on SARS-CoV-2 infection, a highly transmissible virus responsible for the COVID-19 pandemic. The pandemic took significant human lives, causing severe respiratory illnesses and exhibiting various symptoms ranging from fever and cough to gastrointestinal, cardiac, renal, neurological, and other manifestations.<h4>Methods</h4>To investigate the underlying mechanisms of SARS-CoV-2 infection-induced dysregulation of human pathobiology, we construct a two-level PPI network and employed a differential evolution-based graph coloring (DEGCP) algorithm to identify critical hub proteins that might serve as potential targets for resolving the associated issues. Initially, we concentrate on the direct human interactors of SARS-CoV-2 proteins to construct the first-level PPI network and subsequently applied the DEGCP algorithm to identify essential hub proteins within this network. We then build a second-level PPI network by incorporating the next-level human interactors of the first-level hub proteins and use the DEGCP algorithm to predict the second level of hub proteins.<h4>Results</h4>We first identify the potential crucial hub proteins associated with SARS-CoV-2 infection at different levels. Through comprehensive analysis, we then investigate the cellular localization, interactions with other viral families, involvement in biological pathways and processes, functional attributes, gene regulation capabilities as transcription factors, and their associations with disease-associated symptoms of these identified hub proteins. Our findings highlight the significance of these hub proteins and their intricate connections with disease pathophysiology. Furthermore, we predict potential drug targets among the hub proteins and identify specific drugs that hold promise in preventing or treating SARS-CoV-2 infection and its consequences.<h4>Conclusion</h4>Our generic model demonstrates the effectiveness of DEGCP algorithm in analyzing biological PPI networks, provides valuable insights into disease biology, and offers a basis for developing novel therapeutic strategies for other viral infections that may cause future pandemic.

Also flagged:sirolimusrosuvastatincoronary artery diseaseTNFAKT1MMP9
Journal Article 2024-02-16 No Snippets Ryu JY, Jang EH, Lee J, Kim JH, Youn YN.
Show Full Abstract

<h4>Background</h4>Coronary artery bypass graft (CABG) is generally used to treat complex coronary artery disease. Treatment success is affected by neointimal hyperplasia (NIH) of graft and anastomotic sites. Although sirolimus and rosuvastatin individually inhibit NIH progression, the efficacy of combination treatment remains unknown.<h4>Methods</h4>We identified cross-targets associated with CABG, sirolimus, and rosuvastatin by using databases including DisGeNET and GeneCards. GO and KEGG pathway enrichment analyses were conducted using R studio, and target proteins were mapped in PPI networks using Metascape and Cytoscape. For in vivo validation, we established a balloon-injured rabbit model by inducing NIH and applied a localized perivascular drug delivery device containing sirolimus and rosuvastatin. The outcomes were evaluated at 1, 2, and 4 weeks post-surgery.<h4>Results</h4>We identified 115 shared targets between sirolimus and CABG among databases, 23 between rosuvastatin and CABG, and 96 among all three. TNF, AKT1, and MMP9 were identified as shared targets. Network pharmacology predicted the stages of NIH progression and the corresponding signaling pathways linked to sirolimus (acute stage, IL6/STAT3 signaling) and rosuvastatin (chronic stage, Akt/MMP9 signaling). In vivo experiments demonstrated that the combination of sirolimus and rosuvastatin significantly suppressed NIH progression. This combination treatment also markedly decreased the expression of inflammation and Akt signaling pathway-related proteins, which was consistent with the predictions from network pharmacology analysis.<h4>Conclusions</h4>Sirolimus and rosuvastatin inhibited pro-inflammatory cytokine production during the acute stage and regulated Akt/mTOR/NF-κB/STAT3 signaling in the chronic stage of NIH progression. These potential synergistic mechanisms may optimize treatment strategies to improve long-term patency after CABG.

TNFSF4
Also flagged:tumorcystinedisulfidesSLC7A11glucosedisulfide
Journal Article 2024-02-16 ✓ 5 Snippets Zhou Y, Qin X, Hu Q, Qin S, Xu R, Gu K, Lu H.
In-Text Gene Mentions

In addition, we obtained representative IHC staining images of CD276, TNFSF4, TNFRSF14, CD40, TNFSF14, and TNFRSF18 in both normal tissues and glioblastoma samples from the Human Proteome Atlas (Supplementary Fig. 9).

The results of univariate Cox analysis showed that increased expression of CD276 (HR 1.47, 95% confidence interval (CI) 1.10–1.97, p = 0.011), TNFRSF14 (HR 1.39, 95% CI 1.09–1.78, p = 0.009), TNFSF14 (HR 1.29, 95% CI 1.07–1.55, p = 0.007), TNFRSF9 (HR 1.60, 95% CI 1.11–2.31, p = 0.013), TNFSF4 (HR 1.48, 95% CI 1.20–1.84, p < 0.001), CD70 (HR 1.17, 95% CI 1.02–1.34, p = 0.025), CD40 (HR 1.39, 95% CI 1.07–1.79, p = 0.013), TNFRSF18 (HR 1.34, 95% CI 1.10–1.63, p = 0.003), and CD96 (HR 1.59, 95% CI 1.11–2.28, p = 0.012) were associated with poor prognoses of glioblastoma (Fig. 1B).

Based on these findings, we established a risk signature comprised of CD276, TNFRSF14, TNFSF14, TNFSF4, CD40, and TNFRSF18 to predict OS and response to immune checkpoint blockade in glioblastoma patients.

Our model genes are also associated with immune therapy response in glioblastoma, including T cell co-stimulatory molecules like TNFRSF18 and TNFSF4.

Similar associations were observed in the CGGA-glioblastoma cohort for CD40, CD276, TNFRSF14, and TNFSF14, except for TNFSF4 and TNFRSF18 (Supplementary Fig. 4).

Show Full Abstract

Disulfidptosis is a condition where dysregulated NAPDH levels and abnormal accumulation of cystine and other disulfides occur in cells with high SLC7A11 expression under glucose deficiency. This disrupts normal formation of disulfide bonds among cytoskeletal proteins, leading to histone skeleton collapse and triggering cellular apoptosis. However, the correlation between disulfidptosis and immune responses in relation to glioblastoma survival rates and immunotherapy sensitivity remains understudied. Therefore, we utilized The Cancer Genome Atlas and The Chinese Glioma Genome Atlas to identify disulfidptosis-related immune checkpoint genes and established an overall survival (OS) prediction model comprising six genes: CD276, TNFRSF 14, TNFSF14, TNFSF4, CD40, and TNFRSF18, which could also be used for predicting immunotherapy sensitivity. We identified a cohort of glioblastoma patients classified as high-risk, which exhibited an upregulation of angiogenesis, extracellular matrix remodeling, and epithelial-mesenchymal transition as well as an immunosuppressive tumor microenvironment (TME) enriched with tumor associated macrophages, tumor associated neutrophils, CD8<sup> +</sup> T-cell exhaustion. Immunohistochemical staining of CD276 in 144 cases further validated its negative correlation with OS in glioma. Disulfidptosis has the potential to induce chronic inflammation and an immunosuppressive TME in glioblastoma.

TNFSF4
Also flagged:canceracute promyelocytic leukemiaPMLall-trans retinoic acidarsenic trioxideATO
Journal Article 2024-02-16 ✓ 1 Snippet Jin W, Jin W, Dai Y, Chen L, Zhu H, Dong F, Zhu H, Meng G, Li J, Chen S, Chen Z, Fang H, Wang K.
In-Text Gene Mentions

…, MAP2K1 ,TNFSF4, OLFML2A ,…

Show Full Abstract

Acute promyelocytic leukemia (APL) represents a paradigm for targeted differentiation therapy, with a minority of patients experiencing treatment failure and even early death. We here report a comprehensive single-cell analysis of 16 APL patients, uncovering cellular compositions and their impact on all-trans retinoic acid (ATRA) response in vivo and early death. We unveil a cellular differentiation hierarchy within APL blasts, rooted in leukemic stem-like cells. The oncogenic PML/RARα fusion protein exerts branch-specific regulation in the APL trajectory, including stem-like cells. APL cohort analysis establishes an association of leukemic stemness with elevated white blood cell counts and FLT3-ITD mutations. Furthermore, we construct an APL-specific stemness score, which proves effective in assessing early death risk. Finally, we show that ATRA induces differentiation of primitive blasts and patients with early death exhibit distinct stemness-associated transcriptional programs. Our work provides a thorough survey of APL cellular hierarchies, offering insights into cellular dynamics during targeted therapy.

ECI2
Also flagged:peroxisomesperoxisomal biogenesis disordersmitochondrialgene expressionlipidmetabolism
Journal Article 2024-02-16 ✓ 3 Snippets Plessner M, Thiele L, Hofhuis J, Thoms S.
In-Text Gene Mentions

… 3,2-trans-enoyl-CoA isomeraseECI2[ 63 ]…

…BothECI2isoforms, having either…

ECI2shows a basal…

Show Full Abstract

Peroxisomes are primarily studied in the brain, kidney, and liver due to the conspicuous tissue-specific pathology of peroxisomal biogenesis disorders. In contrast, little is known about the role of peroxisomes in other tissues such as the heart. In this meta-analysis, we explore mitochondrial and peroxisomal gene expression on RNA and protein levels in the brain, heart, kidney, and liver, focusing on lipid metabolism. Further, we evaluate a potential developmental and heart region-dependent specificity of our gene set. We find marginal expression of the enzymes for peroxisomal fatty acid oxidation in cardiac tissue in comparison to the liver or cardiac mitochondrial β-oxidation. However, the expression of peroxisome biogenesis proteins in the heart is similar to other tissues despite low levels of peroxisomal fatty acid oxidation. Strikingly, peroxisomal targeting signal type 2-containing factors and plasmalogen biosynthesis appear to play a fundamental role in explaining the essential protective and supporting functions of cardiac peroxisomes.

PRDX6
Also flagged:senescencetumorwound healingagingtelomeredegradation
Journal Article 2024-02-16 ✓ 3 Snippets Sun DY, Wu WB, Wu JJ, Shi Y, Xu JJ, Ouyang SX, Chi C, Shi Y, Ji QX, Miao JH, Fu JT, Tong J, Zhang PP, Zhang JB, Li ZY, Qu LF, Shen FM, Li DJ, Wang P.
In-Text Gene Mentions

Interestingly, in a public microarray dataset (No. #GSE1011, Supplementary Fig. 14A) aimed to explore the altered genes in aorta of mice treated with PPARγ agonist rosiglitazone, we found PPARγ activation upregulated anti-ferroptotic genes including Gpx4, Nfs1, Dhodh, Prdx6, etc., and suppressed pro-ferroptotic genes including Atf3 and Dusp1 in mice aorta (Supplementary Fig. 14B).

…Nfs1 , Dhodh,Prdx6, etc.,…

…Dhodh, Nsf1 andPrdx6(Supplementary Fig. 14C…

Show Full Abstract

Senescence of vascular smooth muscle cells (VSMCs) contributes to aging-related cardiovascular diseases by promoting arterial remodelling and stiffness. Ferroptosis is a novel type of regulated cell death associated with lipid oxidation. Here, we show that pro-ferroptosis signaling drives VSMCs senescence to accelerate vascular NAD<sup>+</sup> loss, remodelling and aging. Pro-ferroptotic signaling is triggered in senescent VSMCs and arteries of aged mice. Furthermore, the activation of pro-ferroptotic signaling in VSMCs not only induces NAD<sup>+</sup> loss and senescence but also promotes the release of a pro-senescent secretome. Pharmacological or genetic inhibition of pro-ferroptosis signaling, ameliorates VSMCs senescence, reduces vascular stiffness and retards the progression of abdominal aortic aneurysm in mice. Mechanistically, we revealed that inhibition of pro-ferroptotic signaling facilitates the nuclear-cytoplasmic shuttling of proliferator-activated receptor-γ and, thereby impeding nuclear receptor coactivator 4-ferrtin complex-centric ferritinophagy. Finally, the activated pro-ferroptotic signaling correlates with arterial stiffness in a human proof-of-concept study. These findings have significant implications for future therapeutic strategies aiming to eliminate vascular ferroptosis in senescence- or aging-associated cardiovascular diseases.

HFE
Also flagged:Autoimmune hepatitisCOVID-19inflammatory liver diseasehepatitiscoronavirus disease 2019ALT
Journal Article 2024-02-16 ✓ 1 Snippet Kochhar S, Assis DN, Mack C, Izurieta HS, Muratori L, Munoz A, Nordenberg D, Gidudu JF, Blau EF, Vierling JM.
In-Text Gene Mentions

Hemochromatosis

Show Full Abstract

This report introduces a Brighton Collaboration (BC) case definition for autoimmune hepatitis (AIH), which has been classified as a priority adverse event of special interest (AESI), as there were possible cases seen following COVID-19 vaccination. The case definition was developed by a group of subject matter and BC process experts to facilitate safety data comparability across pre- and post-licensure clinical trials, as well as pharmacovigilance activities in multiple settings with diverse resources and healthcare access. The usual BC case definition development process was followed in an expedited manner, and took two months to complete, including finalising the manuscript for publication, instead of the usual 1 year development time. It includes a systematic review of the literature and an expert consensus to define levels of diagnostic certainty for AIH, and provides specific guidelines for data collection and analysis. Histology, serological and biochemical tests and exclusion of alternate diagnosis were considered necessary to define the levels of certainty (definitive, probable and possible). AEFI reports of suspected AIH were independently classified by the WG members to test its useability and these classifications were used to finalise the case definition. The document underwent peer review by external AIH experts and a Reference Group of vaccine safety stakeholders in high-, low- and middle-income countries to ensure case definition useability, applicability, and scientific integrity. The expedited process can be replicated for development of other standardised case definitions for priority AESIs for endemics and epidemics. While applicable to cases reported following immunisation, the case definition is independent of lapsed time following vaccination and, as such, can also be used to determine background incidence for vaccinated and unvaccinated control groups in studies of causal association. While use of this case definition is also appropriate for the study of safety of other products including drugs, it is not meant to guide clinical case management.

Also flagged:urothelial carcinomacystitisCD34segmentationUrothelial Carcinomashematoxylin
Journal Article 2024-02-16 No Snippets Ceachi B, Cioplea M, Mustatea P, Gerald Dcruz J, Zurac S, Cauni V, Popp C, Mogodici C, Sticlaru L, Cioroianu A, Busca M, Stefan O, Tudor I, Dumitru C, Vilaia A, Oprisan A, Bastian A, Nichita L.
Show Full Abstract

The presence of lymphovascular invasion (LVI) in urothelial carcinoma (UC) is a poor prognostic finding. This is difficult to identify on routine hematoxylin-eosin (H&E)-stained slides, but considering the costs and time required for examination, immunohistochemical stains for the endothelium are not the recommended diagnostic protocol. We developed an AI-based automated method for LVI identification on H&E-stained slides. We selected two separate groups of UC patients with transurethral resection specimens. Group A had 105 patients (100 with UC; 5 with cystitis); group B had 55 patients (all with high-grade UC; D2-40 and CD34 immunohistochemical stains performed on each block). All the group A slides and 52 H&E cases from group B showing LVI using immunohistochemistry were scanned using an Aperio GT450 automatic scanner. We performed a pixel-per-pixel semantic segmentation of selected areas, and we trained InternImage to identify several classes. The DiceCoefficient and Intersection-over-Union scores for LVI detection using our method were 0.77 and 0.52, respectively. The pathologists' H&E-based evaluation in group B revealed 89.65% specificity, 42.30% sensitivity, 67.27% accuracy, and an F1 score of 0.55, which is much lower than the algorithm's DCC of 0.77. Our model outlines LVI on H&E-stained-slides more effectively than human examiners; thus, it proves a valuable tool for pathologists.

Also flagged:Toxinspeptidescysteinehyaluronidaseserine proteasepeptidases
Journal Article 2024-02-16 No Snippets Rodrigo AP, Moutinho Cabral I, Alexandre A, Costa PM.
Show Full Abstract

Proteinaceous toxins are peptides or proteins that hold great biotechnological value, evidenced by their ecological role, whether as defense or predation mechanisms. Bioprospecting using bioinformatics and omics may render screening for novel bioactives more expeditious, especially considering the immense diversity of toxin-secreting marine organisms. <i>Eulalia</i> sp. (Annelida: Phyllodocidae), a toxin bearing marine annelid, was recently shown to secrete cysteine-rich protein (Crisp) toxins (hitherto referred to as 'phyllotoxins') that can immobilize its prey. By analyzing and validating transcriptomic data, we narrowed the list of isolated full coding sequences of transcripts of the most abundant toxins or accompanying bioactives secreted by the species (the phyllotoxin Crisp, hyaluronidase, serine protease, and peptidases M12A, M13, and M12B). Through homology matching with human proteins, the biotechnological potential of the marine annelid's toxins and related proteins was tentatively associated with coagulative and anti-inflammatory responses for the peptidases PepM12A, SePr, PepM12B, and PepM13, and with the neurotoxic activity of Crisp, and finally, hyaluronidase was inferred to bear properties of an permeabilizing agent. The in silico analysis succeeded by validation by PCR and Sanger sequencing enabled us to retrieve cDNAs can may be used for the heterologous expression of these toxins.

Also flagged:Prostate Cancersmall cell PCtumorsandrogen receptorARandrogen
Journal Article 2024-02-16 No Snippets Kouroukli O, Bravou V, Giannitsas K, Tzelepi V.
Show Full Abstract

Prostate cancer (PC) is a common malignancy among elderly men, characterized by great heterogeneity in its clinical course, ranging from an indolent to a highly aggressive disease. The aggressive variant of prostate cancer (AVPC) clinically shows an atypical pattern of disease progression, similar to that of small cell PC (SCPC), and also shares the chemo-responsiveness of SCPC. The term AVPC does not describe a specific histologic subtype of PC but rather the group of tumors that, irrespective of morphology, show an aggressive clinical course, dictated by androgen receptor (AR) indifference. AR indifference represents an adaptive response to androgen deprivation therapy (ADT), driven by epithelial plasticity, an inherent ability of tumor cells to adapt to their environment by changing their phenotypic characteristics in a bi-directional way. The molecular profile of AVPC entails combined alterations in the tumor suppressor genes retinoblastoma protein 1 (RB1), tumor protein 53 (TP53), and phosphatase and tensin homolog (PTEN). The understanding of the biologic heterogeneity of castration-resistant PC (CRPC) and the need to identify the subset of patients that would potentially benefit from specific therapies necessitate the development of prognostic and predictive biomarkers. This review aims to discuss the possible pathophysiologic mechanisms of AVPC development and the potential use of emerging tissue-based biomarkers in clinical practice.

DCC
Also flagged:Netrin-1 receptorNetrin-1axonsbehaviouralasleepACC
Journal Article 2024-02-16 ✓ 5 Snippets Prato A, Cirnigliaro L, Maugeri F, Luca A, Giuliano L, Vitiello G, Errichiello E, Valente EM, Del Giudice E, Mostile G, Rizzo R, Barone R.
In-Text Gene Mentions

Biallelic loss-of-function DCC variants have also been reported in patients with developmental split-brain syndrome (DSBS, MIM# 617542), a more complex syndrome associated with ACC, intellectual disability, scoliosis and horizontal gaze palsy, with or without mirror movements (MMs) [12].

Sex-biased phenotypic expression of ACC and MMs in individuals with DCC mutations may be associated with the regulation of the DCC by testosterone levels during prenatal brain development [7].

The present patient harboured a novel monoallelic DCC missense variant associated with delayed psychomotor development, intellectual disability, MMs and complete ACC.

…colorectal cancer gene (DCC), encoding the Netrin-1…

…biological function ofDCCin the corpus…

Show Full Abstract

<b>Background/Objectives</b>: Pathogenic variants in the deleted in colorectal cancer gene (DCC), encoding the Netrin-1 receptor, may lead to mirror movements (MMs) associated with agenesis/dysgenesis of the corpus callosum (ACC) and cognitive and/or neuropsychiatric issues. The clinical phenotype is related to the biological function of DCC in the corpus callosum and corticospinal tract development as Netrin-1 is implicated in the guidance of developing axons toward the midline. We report on a child with a novel inherited, monoallelic, pathogenic variant in the DCC gene. <b>Methods</b>: Standardized measures and clinical scales were used to assess psychomotor development, communication and social skills, emotional and behavioural difficulties. MMs were measured via the Woods and Teuber classification. Exome sequencing was performed on affected and healthy family members. <b>Results</b>: The patient's clinical presentation during infancy consisted of paroxysmal dystonic posturing when asleep, mimicking nocturnal leg cramps. A brain magnetic resonance imaging (MRI) showed complete ACC. He developed typical upper limb MMs during childhood and a progressively evolving neuro-phenotype with global development delay and behavioural problems. We found an intrafamilial clinical variability associated with DCC mutations: the proband's father and uncle shared the same DCC variant, with a milder clinical phenotype. The atypical early clinical presentation of the present patient expands the clinical spectrum associated with DCC variants, especially those in the paediatric age. <b>Conclusions</b>: This study underlines the importance of in-depth genetic investigations in young children with ACC and highlights the need for further detailed analyses of early motor symptoms in infants with DCC mutations.

HFE
Also flagged:liver diseasemetabolic dysfunction-associated steatotic liver diseaseLSALTMetabolic dysfunctionsteatotic liver disease
Journal Article 2024-02-16 ✓ 1 Snippet Gopalakrishna H, Nair GB, Salman Roghani R, Ravendhran N, Rotman Y.
In-Text Gene Mentions

hemochromatosis

Show Full Abstract

<h4>Background</h4>Most people with metabolic dysfunction-associated steatotic liver disease (MASLD) lack significant fibrosis and are considered low-risk. Surveillance strategy for low-risk MASLD remains uncertain.<h4>Aim</h4>Identify which low-risk subjects can avoid follow-up vibration-controlled transient elastography (VCTE) within 1 year.<h4>Methods</h4>Retrospective analysis of two independent low-risk MASLD cohorts (baseline liver stiffness [LS] < 8kPa) with routine 6-12 months follow-up VCTE. The primary outcome was LS ≥ 8kPa on follow-up, requiring referral and further work-up according to current guidance. Predictors of the primary outcome on univariate and multivariate logistic regression were incorporated into a decision algorithm, and validated in an independent cohort.<h4>Results</h4>Of 206 subjects in the derivation cohort, 96 were low-risk. After a median of 10 months, 24 (25%) low-risk subjects had LS ≥ 8kPa. Baseline LS ( P  < 0.01) and ALT change from baseline ( P  = 0.02) (multivariate AUROC = 0.84 [0.74-0.94]) predicted the primary outcome, and were incorporated to a two-step decision algorithm. Low-risk subjects with baseline LS < 5.5 kPa can avoid repeating VCTE in a year, while those with LS > 6.8 kPa require one. For intermediate baseline LS (5.5-6.8kPa), repeat VCTE is only indicated when ALT increase > 6 U/L. The algorithm had 92% negative predictive value, 78% specificity, and 78% accuracy in the derivation cohort. In the validation cohort (n = 64), it had 91% NPV, 72% specificity, and 71% accuracy.<h4>Conclusion</h4>In low-risk MASLD, a simple algorithm combining baseline LS and ALT change can be used to safely avoid a repeat VCTE in a year.

Also flagged:synthesistetrazinenorbornenehydroxylcarbic anhydridedegradation
Journal Article 2024-02-16 No Snippets Dimmitt NH, Lin CC.
Show Full Abstract

The inverse electron demand Diels-Alder (iEDDA) reactions are highly efficient click chemistry increasingly utilized in bioconjugation, live cell labeling, and the synthesis and modification of biomaterials. iEDDA click reactions have also been used to cross-link tetrazine (Tz) and norbornene (NB) modified macromers [e.g., multiarm poly(ethylene glycol) or PEG]. In these hydrogels, Tz-NB adducts exhibit stable supramolecular interactions with a high hydrolytic stability. Toward engineering a new class of PEG-based click hydrogels with highly adaptable properties, we previously reported a new group of NB-derivatized PEG macromers via reacting hydroxyl-terminated PEG with carbic anhydride (CA). In this work, we show that hydrogels cross-linked by PEGNB<sub>CA</sub> or its derivatives exhibited fast and tunable hydrolytic degradation. Here, we show that PEGNB<sub>CA</sub> (either mono- or octafunctional) and its dopamine or tyramine conjugated derivatives (i.e., PEGNB-D and PEGNB-T) readily cross-link with 4-arm PEG-Tz to form a novel class of multifunctional iEDDA click hydrogels. Through modularly adjusting the macromers with unstable and stable iEDDA click-induced supramolecular interactions (iEDDA-CSI), we achieved highly tunable degradation, with full degradation in less than 2 weeks to over two months. We also show that secondary enzymatic reactions could dynamically stiffen these hydrogels. These hydrogels could also be spatiotemporally photopatterned through visible light-initiated photochemistry. Finally, the iEDDA-CSI hydrogels post ester hydrolysis displayed shear-thinning and self-healing properties, enabling injectable delivery.

OLFM4
Also flagged:colorectal cancerextracellularcollagen type IAP-1tumorTNF
Journal Article 2024-02-16 ✓ 5 Snippets Ogasawara N, Kano Y, Yoneyama Y, Kobayashi S, Watanabe S, Kirino S, Velez-Bravo FD, Hong Y, Ostapiuk A, Lutsik P, Onishi I, Yamauchi S, Hiraguri Y, Ito G, Kinugasa Y, Ohashi K, Watanabe M, Okamoto R, Tejpar S, Yui S.
In-Text Gene Mentions

Interestingly, when medium supernatant from 2D HC was applied to 3D MG for five days, an increase of YAP target genes (F3, CYR61, and CTGF) and a fetal marker gene (TACSTD2), as well as a decrease of stem cell markers (OLFM4, SMOC2, and LGR5), were induced, suggesting that TNF is secreted from 2D HC cancer cells.

…as LGR5, SMOC2,OLFM4, LRIG1, EPHB3, and…

…both SMOC2 andOLFM4expression decreases in…

…CBC signature, includingOLFM4, SMOC2, BLNK, IRS1,…

…cell markers (OLFM4, SMOC2 ,…

Show Full Abstract

In normal intestines, a fetal/regenerative/revival cell state can be induced upon inflammation. This plasticity in cell fate is also one of the current topics in human colorectal cancer (CRC). To dissect the underlying mechanisms, we generated human CRC organoids with naturally selected genetic mutation profiles and exposed them to two different conditions by modulating the extracellular matrix (ECM). Among tested mutation profiles, a fetal/regenerative/revival state was induced following YAP activation via a collagen type I-enriched microenvironment. Mechanistically, YAP transcription was promoted by activating AP-1 and TEAD-dependent transcription and suppressing intestinal lineage-determining transcription via mechanotransduction. The phenotypic conversion was also involved in chemoresistance, which could be potentially resolved by targeting the underlying YAP regulatory elements, a potential target of CRC treatment.

Also flagged:Cystatin CCreatinineglomerular filtrationthyroid dysfunctionchronic inflammatory diseasesteroid
Journal Article 2024-02-16 No Snippets Chen DC, Lu K, Scherzer R, Lees JS, Rutherford E, Mark PB, Potok OA, Rifkin DE, Ix JH, Shlipak MG, Estrella MM.
Show Full Abstract

<h4>Rationale & objective</h4>Large differences between estimated glomerular filtration rate (eGFR) based on cystatin C (eGFRcys) and creatinine (eGFRcr) occur commonly. A comprehensive evaluation of factors that contribute to these differences is needed to guide the interpretation of discrepant eGFR values.<h4>Study design</h4>Cohort study.<h4>Setting & participants</h4>468,969 participants in the UK Biobank.<h4>Exposures</h4>Candidate sociodemographic, lifestyle factors, comorbidities, medication usage, and physical and laboratory predictors.<h4>Outcomes</h4>eGFRdiff, defined as eGFRcys minus eGFRcr, categorized into 3 levels: lower eGFRcys (eGFRdiff, less than -15 mL/min/1.73 m<sup>2</sup>), concordant eGFRcys and eGFRcr (eGFRdiff, -15 to < 15 mL/min/1.73 m<sup>2</sup>), and lower eGFRcr (eGFRdiff, ≥15 mL/min/1.73 m<sup>2</sup>).<h4>Analytical approach</h4>Multinomial logistic regression models were constructed to identify predictors of lower eGFRcys or lower eGFRcr. We developed 2 prediction models comprising 375,175 participants: (1) a clinical model using clinically available variables and (2) an enriched model additionally including lifestyle variables. The models were internally validated in an additional 93,794 participants.<h4>Results</h4>Mean ± standard deviation of eGFRcys was 88 ± 16 mL/min/1.73 m<sup>2</sup>, and eGFRcr was 95 ± 13 mL/min/1.73 m<sup>2</sup>; 25% and 5% of participants were in the lower eGFRcys and lower eGFRcr groups, respectively. In the multivariable enriched model, strong predictors of lower eGFRcys were older age, male sex, South Asian ethnicity, current smoker (vs never smoker), history of thyroid dysfunction, chronic inflammatory disease, steroid use, higher waist circumference and body fat, and urinary albumin-creatinine ratio >300 mg/g. Odds ratio estimates for these predictors were largely inverse of those in the lower eGFRcr group. The model's area under the curve was 0.75 in the validation set, with good calibration (1.00).<h4>Limitations</h4>Limited generalizability.<h4>Conclusions</h4>This study highlights the multitude of demographic, lifestyle, and health characteristics that are associated with large eGFRdiff. The clinical model may identify individuals who are likely to have discrepant eGFR values and thus should be prioritized for cystatin C testing.

bioRxiv 2024-02-16 Preprint (No Snippets API) Pereira MF, Finazzi V, Rizzuti L, Aprile D, Aiello V, Mollica L, Riva M, Soriani C, Dossena F, Shyti R, Castaldi D, Tenderini E, Carminho-Rodrigues MT, Bally JF, de Vries BB, Gabriele M, Vitriolo A, Testa G.
Show Full Abstract

Germline mutations of YY1 cause Gabriele-de Vries syndrome (GADEVS), a neurodevelopmental disorder featuring intellectual disability and a wide range of systemic manifestations. To dissect the cellular and molecular mechanisms underlying GADEVS, we combined large-scale imaging, single-cell multiomics and gene regulatory network reconstruction in 2D and 3D patient-derived physiopathologically relevant cell lineages. YY1 haploinsufficiency causes a pervasive alteration of cell type specific transcriptional networks, disrupting corticogenesis at the level of neural progenitors and terminally differentiated neurons, including cytoarchitectural defects reminiscent of GADEVS clinical features. Transcriptional alterations in neurons propagated to neighboring astrocytes through a major non-cell autonomous pro-inflammatory effect that grounds the rationale for modulatory interventions. Together, neurodevelopmental trajectories, synaptic formation and neuronal-astrocyte cross talk emerged as salient domains of YY1 dosage-dependent vulnerability. Mechanistically, cell-type resolved reconstruction of gene regulatory networks uncovered the regulatory interplay between YY1, NEUROG2 and ETV5 and its aberrant rewiring in GADEVS. Our findings underscore the reach of advanced in vitro models in capturing developmental antecedents of clinical features and exposing their underlying mechanisms to guide the search for targeted interventions.

PEBP1
Also flagged:Ankylosing spondylitisASchronicautoimmune inflammatory diseaseossificationankylosis
Journal Article 2024-02-15 ✓ 1 Snippet Feng X, Wang C, Ji B, Qiao J, Xu Y, Zhu S, Ji Z, Zhou B, Tong W, Xu W.
In-Text Gene Mentions

…expressed PRTN3, IGFBP7,PEBP1and BEX3.…

Show Full Abstract

<h4>Objectives</h4>This study aimed to identify the types and heterogeneity of cells within the spinal enthesis and investigate the underlying mechanisms of osteogenesis.<h4>Methods</h4>Single-cell RNA sequencing was used to identify cell populations and their gene signatures in the spinal enthesis of five patients with ankylosing spondylitis (AS) and three healthy individuals. The transcriptomes of 40 065 single cells were profiled and divided into 7 clusters: neutrophils, monocytic cells, granulomonocytic progenitor_erythroblasts, T cells, B cells, plasma cells and stromal cells. Real-time quantitative PCR, immunofluorescence, flow cytometry, osteogenesis induction, alizarin red staining, immunohistochemistry, short hairpin RNA and H&E staining were applied to validate the bioinformatics analysis.<h4>Results</h4>Pseudo-time analysis showed two differentiation directions of stromal cells from the mesenchymal stem cell subpopulation MSC-C2 to two Cxcl12-abundant-reticular (CAR) cell subsets, Osteo-CAR and Adipo-CAR, within which three transcription factors, C-JUN, C-FOS and CAVIN1, were highly expressed in AS and regulated the osteogenesis of mesenchymal stem cells. A novel subcluster of early-stage neutrophils, CD99_G1, was elevated in AS. The proinflammatory characteristics of monocyte dendritic cell progenitor-recombinant adiponectin receptor 2 monocytic cells were explored. Interactions between Adipo-CAR cells, CD99_G1 neutrophils and other cell types were mapped by identifying ligand-receptor pairs, revealing the recruitment characteristics of CD99_G1 neutrophils by Adipo-CAR cells and the pathogenesis of osteogenesis induced in AS.<h4>Conclusions</h4>Our results revealed the dynamics of cell subpopulations, gene expression and intercellular interactions during AS pathogenesis. These findings provide new insights into the cellular and molecular mechanisms of osteogenesis and will benefit the development of novel therapeutic strategies.

Also flagged:substance use disordersalcohol use disordercannabis use disorderopioid use disorderIHO1CADM2
Journal Article 2024-02-15 No Snippets Koller D, Friligkou E, Stiltner B, Pathak GA, Løkhammer S, Levey DF, Zhou H, Hatoum AS, Deak JD, Kember RL, Treur JL, Kranzler HR, Johnson EC, Stein MB, Gelernter J, Polimanti R.
Show Full Abstract

Individuals suffering from chronic pain develop substance use disorders (SUDs) more often than others. Understanding the shared genetic influences underlying the comorbidity between chronic pain and SUDs will lead to a greater understanding of their biology. Genome-wide association statistics were obtained from the UK Biobank for multisite chronic pain (MCP, N<sub>effective</sub> = 387,649) and from the Million Veteran Program and the Psychiatric Genomics Consortium meta-analyses for alcohol use disorder (AUD, N<sub>effective</sub> = 296,974), cannabis use disorder (CanUD, N<sub>effective</sub> = 161,053), opioid use disorder (OUD, N<sub>effective</sub> = 57,120), and problematic tobacco use (PTU, N<sub>effective</sub> = 270,120). SNP-based heritability was estimated for each of the traits and genetic correlation (r<sub>g</sub>) analyses were performed to assess MCP-SUD pleiotropy. Bidirectional Mendelian Randomization analyses evaluated possible causal relationships. Finally, to identify and characterize individual loci, we performed a genome-wide pleiotropy analysis and a brain-wide analysis using imaging phenotypes available from the UK Biobank. MCP was positively genetically correlated with AUD (r<sub>g</sub> = 0.26, p = 7.55 × 10<sup>-18</sup>), CanUD (r<sub>g</sub> = 0.37, p = 8.21 × 10<sup>-37</sup>), OUD (r<sub>g</sub> = 0.20, p = 1.50 × 10<sup>-3</sup>), and PTU (r<sub>g</sub> = 0.29, p = 8.53 × 10<sup>-12</sup>). Although the MR analyses supported bi-directional relationships, MCP had larger effects on AUD (pain-exposure: beta = 0.18, p = 8.21 × 10<sup>-4</sup>; pain-outcome: beta = 0.07, p = 0.018), CanUD (pain-exposure: beta = 0.58, p = 2.70 × 10<sup>-6</sup>; pain-outcome: beta = 0.05, p = 0.014) and PTU (pain-exposure: beta = 0.43, p = 4.16 × 10<sup>-8</sup>; pain-outcome: beta = 0.09, p = 3.05 × 10<sup>-6</sup>) than the reverse. The genome-wide analysis identified two SNPs pleiotropic between MCP and all SUD investigated: IHO1 rs7652746 (p<sub>pleiotropy</sub> = 2.69 × 10<sup>-8</sup>), and CADM2 rs1248857 (p<sub>pleiotropy</sub> = 1.98 × 10<sup>-5</sup>). In the brain-wide analysis, rs7652746 was associated with multiple cerebellum and amygdala imaging phenotypes. When analyzing MCP pleiotropy with each SUD separately, we found 25, 22, and 4 pleiotropic variants for AUD, CanUD, and OUD, respectively. To our knowledge, this is the first large-scale study to provide evidence of potential causal relationships and shared genetic mechanisms underlying MCP-SUD comorbidity.

HTT
Also flagged:depressionrespiratory sinus arrhythmiaemotion dysregulationmethamphetaminehydrocephalyautism
Journal Article 2024-02-15 ✓ 1 Snippet Perry KJ, Level RA, Schuetze P, Eiden RD.
In-Text Gene Mentions

5-HTT

Show Full Abstract

Prenatal tobacco exposure (PTE) and tobacco-cannabis coexposure (PTCE) co-occur with negative maternal emotional functioning (termed prenatal risks) and together increase risk for child regulatory problems at early school age (ESA). Little is known about developmental processes in early childhood that may mediate this association. We examined two hypothesized mediational processes linking prenatal risks to ESA emotion regulation (ER) and lability-negativity; parasympathetic functioning at toddler age and chronic risk reflected by continued postnatal maternal negative emotional functioning (i.e., depression, anger/hostility, and emotion dysregulation) and substance exposure. Congruent with differential susceptibility theory, we examined interactions between sensitive parenting and toddler parasympathetic functioning predicting ESA ER. Finally, we explored the role of child sex as a moderator. Mothers (<i>N</i> = 247; 53% male infants; 51% Black, 31% White, 19% Hispanic, and 8% other or mixed race) were recruited in the first trimester of pregnancy into one of three groups: PTE (<i>n</i> = 81), PTCE (<i>n</i> = 97), and no substance exposure (<i>n</i> = 69) matched on age and education. Substance exposure was assessed using multiple methods, maternal negative emotional functioning via self-reports, parenting with observations, and child ER using teacher, maternal, and lab assessor reports. Results supported a chronic risk pathway with less support for a parasympathetic pathway. Toddlers who demonstrated respiratory sinus arrhythmia withdrawal to frustration were susceptible to the positive context of sensitive parenting in predicting higher ER. Results emphasize the importance of chronicity of postnatal risks including substance exposure and evaluating the differential impact of positive environments for children with substance exposure. (PsycInfo Database Record (c) 2024 APA, all rights reserved).

Also flagged:CysteinemitochondrialglioblastomaGlucoseamino acidmetabolism
Journal Article 2024-02-15 No Snippets Noch EK, Palma L, Yim I, Bullen N, Barnett D, Walsh A, Bhinder B, Benedetti E, Krumsiek J, Gurvitch J, Khwaja S, Atlas D, Elemento O, Cantley LC.
Show Full Abstract

Glucose and amino acid metabolism are critical for glioblastoma (GBM) growth, but little is known about the specific metabolic alterations in GBM that are targetable with FDA-approved compounds. To investigate tumor metabolism signatures unique to GBM, we interrogated The Cancer Genome Atlas for alterations in glucose and amino acid signatures in GBM relative to other human cancers and found that GBM exhibits the highest levels of cysteine and methionine pathway gene expression of 32 human cancers. Treatment of patient-derived GBM cells with the FDA-approved single cysteine compound N-acetylcysteine (NAC) reduced GBM cell growth and mitochondrial oxygen consumption, which was worsened by glucose starvation. Normal brain cells and other cancer cells showed no response to NAC. Mechanistic experiments revealed that cysteine compounds induce rapid mitochondrial H<sub>2</sub>O<sub>2</sub> production and reductive stress in GBM cells, an effect blocked by oxidized glutathione, thioredoxin, and redox enzyme overexpression. From analysis of the clinical proteomic tumor analysis consortium (CPTAC) database, we found that GBM cells exhibit lower expression of mitochondrial redox enzymes than four other cancers whose proteomic data are available in CPTAC. Knockdown of mitochondrial thioredoxin-2 in lung cancer cells induced NAC susceptibility, indicating the importance of mitochondrial redox enzyme expression in mitigating reductive stress. Intraperitoneal treatment of mice bearing orthotopic GBM xenografts with a two-cysteine peptide induced H<sub>2</sub>O<sub>2</sub> in brain tumors in vivo. These findings indicate that GBM is uniquely susceptible to NAC-driven reductive stress and could synergize with glucose-lowering treatments for GBM.

Also flagged:polypropylenepolyethylenePHA synthasegranulesamino acidspolyhydroxyalkanoate
Journal Article 2024-02-15 No Snippets Neoh SZ, Tan HT, Trakunjae C, Chek MF, Vaithanomsat P, Hakoshima T, Sudesh K.
Show Full Abstract

<h4>Background</h4>Among the polyhydroxyalkanoate (PHA), poly[(R)-3-hydroxybutyrate-co-(R)-3-hydroxyhexanoate] [P(3HB-co-3HHx)] is reported to closely resemble polypropylene and low-density polyethylene. Studies have shown that PHA synthase (PhaC) from mangrove soil (PhaC<sub>BP-M-CPF4</sub>) is an efficient PhaC for P(3HB-co-3HHx) production and N-termini of PhaCs influence its substrate specificity, dimerization, granule morphology, and molecular weights of PHA produced. This study aims to further improve PhaC<sub>BP-M-CPF4</sub> through N-terminal truncation.<h4>Results</h4>The N-terminal truncated mutants of PhaC<sub>BP-M-CPF4</sub> were constructed based on the information of the predicted secondary and tertiary structures using PSIPRED server and AlphaFold2 program, respectively. The N-terminal truncated PhaC<sub>BP-M-CPF4</sub> mutants were evaluated in C. necator mutant PHB<sup>-</sup>4 based on the cell dry weight, PHA content, 3HHx molar composition, molecular weights, and granule morphology of the PHA granules. The results showed that most transformants harbouring the N-terminal truncated PhaC<sub>BP-M-CPF4</sub> showed a reduction in PHA content and cell dry weight except for PhaC<sub>BP-M-CPF4</sub> G8. PhaC<sub>BP-M-CPF4</sub> G8 and A27 showed an improved weight-average molecular weight (M<sub>w</sub>) of PHA produced due to lower expression of the truncated PhaC<sub>BP-M-CPF4</sub>. Transformants harbouring PhaC<sub>BP-M-CPF4</sub> G8, A27, and T74 showed a reduction in the number of granules. PhaC<sub>BP-M-CPF4</sub> G8 produced higher M<sub>w</sub> PHA in mostly single larger PHA granules with comparable production as the full-length PhaC<sub>BP-M-CPF4</sub>.<h4>Conclusion</h4>This research showed that N-terminal truncation had effects on PHA accumulation, substrate specificity, M<sub>w</sub>, and granule morphology. This study also showed that N-terminal truncation of the amino acids that did not adopt any secondary structure can be an alternative to improve PhaCs for the production of PHA with higher M<sub>w</sub> in mostly single larger granules.

HTT
Also flagged:LMNB1neurodegenerative diseasesneurodegenerative diseaseHuntingtindeathpathogenesis
Journal Article 2024-02-15 ✓ 5 Snippets Wu J, Ren J, Cui H, Xie Y, Tang Y.
In-Text Gene Mentions

Knockdown of HTT or treatment with KPT335, an orally selective inhibitor of nuclear export (SINE), effectively attenuated the pathological phenotypes and alleviated neuronal death caused by BDNF withdrawal.

…The Huntingtin (HTT) mutation involves an…

…The Huntingtin gene (HTT) encoded a protein…

…Knockdown ofHTTby sgRNAs.…

…Furthermore, knockdown ofHTTusing sgHTT-1/2 significantly…

Show Full Abstract

<h4>Background</h4>Different neural subtypes are selectively lost in diverse neurodegenerative diseases. Huntington's disease (HD) is an inherited neurodegenerative disease characterized by motor abnormalities that primarily affect the striatum. The Huntingtin (HTT) mutation involves an expanded CAG repeat, leading to insoluble polyQ, which renders GABA<sup>+</sup> medium spiny neurons (MSN) more venerable to cell death. Human pluripotent stem cells (hPSCs) technology allows for the construction of disease-specific models, providing valuable cellular models for studying pathogenesis, drug screening, and high-throughput analysis.<h4>Methods</h4>In this study, we established a method that allows for rapid and efficient generation of MSNs (> 90%) within 21 days from hPSC-derived neural progenitor cells, by introducing a specific combination of transcription factors.<h4>Results</h4>We efficiently induced several neural subtypes, in parallel, based on the same cell source, and revealed that, compared to other neural subtypes, MSNs exhibited higher polyQ aggregation propensity and overexpression toxicity, more severe dysfunction in BDNF/TrkB signaling, greater susceptibility to BDNF withdrawal, and more severe disturbances in nucleocytoplasmic transport (NCT). We further found that the nuclear lamina protein LMNB1 was greatly reduced in HD neurons and mislocalized to the cytoplasm and axons. Knockdown of HTT or treatment with KPT335, an orally selective inhibitor of nuclear export (SINE), effectively attenuated the pathological phenotypes and alleviated neuronal death caused by BDNF withdrawal.<h4>Conclusions</h4>This study thus establishes an effective method for obtaining MSNs and underscores the necessity of using high-purity MSNs to study HD pathogenesis, especially the MSN-selective vulnerability.

HTT
Also flagged:Autophagycell differentiationinflammatory responsesextracellulardegradationorganelles
Journal Article 2024-02-15 ✓ 4 Snippets Wu Y, Li L, Ning Z, Li C, Yin Y, Chen K, Li L, Xu F, Gao J.
In-Text Gene Mentions

Aggregation of huntingtin (Htt) is a neuropathological hallmark of Huntington’s disease (HD).

…Aggregation of huntingtin (Htt) is a neuropathological…

…PC12 cells, with GFP-Htt(with 74 polyQ…

…the clearance of GFP-Htt(see Fig. 8…

Show Full Abstract

Autophagy is a self-renewal mechanism that maintains homeostasis and can promote tissue regeneration by regulating inflammation, reducing oxidative stress and promoting cell differentiation. The interaction between biomaterials and tissue cells significantly affects biomaterial-tissue integration and tissue regeneration. In recent years, it has been found that biomaterials can affect various processes related to tissue regeneration by regulating autophagy. The utilization of biomaterials in a controlled environment has become a prominent approach for enhancing the tissue regeneration capabilities. This involves the regulation of autophagy in diverse cell types implicated in tissue regeneration, encompassing the modulation of inflammatory responses, oxidative stress, cell differentiation, proliferation, migration, apoptosis, and extracellular matrix formation. In addition, biomaterials possess the potential to serve as carriers for drug delivery, enabling the regulation of autophagy by either activating or inhibiting its processes. This review summarizes the relationship between autophagy and tissue regeneration and discusses the role of biomaterial-based autophagy in tissue regeneration. In addition, recent advanced technologies used to design autophagy-modulating biomaterials are summarized, and rational design of biomaterials for providing controlled autophagy regulation via modification of the chemistry and surface of biomaterials and incorporation of cells and molecules is discussed. A better understanding of biomaterial-based autophagy and tissue regeneration, as well as the underlying molecular mechanisms, may lead to new possibilities for promoting tissue regeneration. Video Abstract.

PRDX6
Also flagged:ferroptosisischemic strokeISTFpolymeraseCDKN1A
Journal Article 2024-02-15 ✓ 5 Snippets Zhang LM, Liang XL, Xiong GF, Xing XL, Zhang QJ, Zhang BR, Liu MW.
In-Text Gene Mentions

In this study, four biomarkers, CDKN1A, GPX4, PRDX1, and PRDX6, were used to diagnose stroke and assess the treatment effects.

…GPX4, PRDX1, andPRDX6) were identified using…

…CDKN1A, PRDX1, andPRDX6were upregulated in…

…GPX4, PRDX1, andPRDX6) are significantly associated…

…(GPX4, PRDX1, andPRDX6) (Fig. 2 e–f).…

Show Full Abstract

Studies have shown that a series of molecular events caused by oxidative stress is associated with ferroptosis and oxidation after ischemic stroke (IS). Differential analysis was performed to identify differentially expressed mRNA (DEmRNAs) between IS and control groups. Critical module genes were identified using weighted gene co-expression network analysis (WGCNA). DEmRNAs, critical module genes, oxidative stress-related genes (ORGs), and ferroptosis-related genes (FRGs) were crossed to screen for intersection mRNAs. Candidate mRNAs were screened based on the protein-protein interaction (PPI) network and the MCODE plug-in. Biomarkers were identified based on two types of machine learning algorithms, and the intersection was obtained. Functional items and related pathways of the biomarkers were identified using gene set enrichment analysis (GSEA). Finally, single-sample GSEA (ssGSEA) and Wilcoxon tests were used to identify differential immune cells. An miRNA-mRNA-TF network was created. Quantitative real-time polymerase chain reaction (qRT-PCR) was performed to verify the expression levels of biomarkers in the IS and control groups. There were 8287 DE mRNAs between the IS and control groups. The genes in the turquoise module were selected as critical module genes for IS. Thirty intersecting mRNAs were screened for overlaps. Seventeen candidate mRNAs were also identified. Four biomarkers (CDKN1A, GPX4, PRDX1, and PRDX6) were identified using two types of machine-learning algorithms. GSEA results indicated that the biomarkers were associated with steroid biosynthesis. Nine types of immune cells (activated B cells and neutrophils) were markedly different between the IS and control groups. We identified 3747 miRNA-mRNA-TF regulatory pairs in the miRNA-mRNA-TF regulatory network, including hsa-miR-4469-CDKN1A-BACH2 and hsa-miR-188-3p-GPX4-ATF2. CDKN1A, PRDX1, and PRDX6 were upregulated in IS samples compared with control samples. This study suggests that four biomarkers (CDKN1A, GPX4, PRDX1, and PRDX6) are significantly associated with IS. This study provides a new reference for the diagnosis and treatment of IS.

Also flagged:cancercell proliferationgrowth hormone receptorP53HIF1ACOPS5
Journal Article 2024-02-15 No Snippets Hua R, Ma YS, Yang L, Hao JJ, Hua QY, Shi LY, Yao XQ, Zhi HY, Liu Z.
Show Full Abstract

Mammals exhibit different rates of cancer, with long-lived species generally showing greater resistance. Although bats have been suggested to be resistant to cancer due to their longevity, this has yet to be systematically examined. Here, we investigate cancer resistance across seven bat species by activating oncogenic genes in their primary cells. Both in vitro and in vivo experiments suggest that Myotis pilosus (MPI) is particularly resistant to cancer. The transcriptomic and functional analyses reveal that the downregulation of three genes (HIF1A, COPS5, and RPS3) largely contributes to cancer resistance in MPI. Further, we identify the loss of a potential enhancer containing the HIF1A binding site upstream of COPS5 in MPI, resulting in the downregulation of COPS5. These findings not only provide direct experimental evidence for cancer resistance in a bat species but also offer insights into the natural mechanisms of cancer resistance in mammals.

Also flagged:Ironsynthesisphosphorusphospho-polymerswaterphospho
Journal Article 2024-02-15 No Snippets Kracíková L, Androvič L, Červený D, Jirát-Ziółkowska N, Babič M, Švábová M, Jirák D, Laga R.
Show Full Abstract

In this work, we present the synthesis and evaluation of magnetic resonance (MR) properties of novel phosphorus/iron-containing probes for dual <sup>31</sup>P and <sup>1</sup>H MR imaging and spectroscopy (MRI and MRS). The presented probes are composed of biocompatible semitelechelic and multivalent phospho-polymers based on poly(2-methacryloyloxyethyl phosphorylcholine) (pMPC) coordinated with small paramagnetic Fe<sup>3+</sup> ions or superparamagnetic maghemite (γ-Fe<sub>2</sub>O<sub>3</sub>) nanoparticles via deferoxamine group linked to the end or along the polymer chains. All probes provided very short <sup>1</sup>H T<sub>1</sub> and T<sub>2</sub> relaxation times even at low iron concentrations. The presence of iron had a significant impact on the shortening of <sup>31</sup>P relaxation, with the effect being more pronounced for probes based on γ-Fe<sub>2</sub>O<sub>3</sub> and multivalent polymer. While the water-soluble probe having one Fe<sup>3+</sup> ion per polymer chain was satisfactorily visualized by both <sup>31</sup>P-MRS and <sup>31</sup>P-MRI, the probe with multiple Fe<sup>3+</sup> ions could only be detected by <sup>31</sup>P-MRS, and the probes consisting of γ-Fe<sub>2</sub>O<sub>3</sub> nanoparticles could not be imaged by either technique due to their ultra-short <sup>31</sup>P relaxations. In this proof-of-principle study performed on phantoms at a clinically relevant magnetic fields, we demonstrated how the different forms and concentrations of iron affect both the <sup>1</sup>H MR signal of the surrounding water molecules and the <sup>31</sup>P MR signal of the phospho-polymer probe. Thus, this double contrast can be exploited to simultaneously visualize body anatomy and monitor probe biodistribution.

KLHL20
Also flagged:ZNRF1HOPSAutophagydegradationRING domain ubiquitin ligaseCG14435
Journal Article 2024-02-15 ✓ 1 Snippet Nicolson S, Manning JA, Lim Y, Jiang X, Kolze E, Dayan S, Umargamwala R, Xu T, Sandow JJ, Webb AI, Kumar S, Denton D.
In-Text Gene Mentions

…CUL3 with adaptorKLHL20, mediates its proteasomal…

Show Full Abstract

Autophagy, the process of elimination of cellular components by lysosomal degradation, is essential for animal development and homeostasis. Using the autophagy-dependent Drosophila larval midgut degradation model we identified an autophagy regulator, the RING domain ubiquitin ligase CG14435 (detour). Depletion of detour resulted in increased early-stage autophagic vesicles, premature tissue contraction, and overexpression of detour or mammalian homologues, ZNRF1 and ZNRF2, increased autophagic vesicle size. The ablation of ZNRF1 or ZNRF2 in mammalian cells increased basal autophagy. We identified detour interacting proteins including HOPS subunits, deep orange (dor/VPS18), Vacuolar protein sorting 16A (VPS16A), and light (lt/VPS41) and found that detour promotes their ubiquitination. The detour mutant accumulated autophagy-related proteins in young adults, displayed premature ageing, impaired motor function, and activation of innate immunity. Collectively, our findings suggest a role for detour in autophagy, likely through regulation of HOPS complex, with implications for healthy aging.

FBXL4
Also flagged:mitophagymitochondriaautophagymitochondrialmembraneBCL2L13
Journal Article 2024-02-15 ✓ 2 Snippets Degli Esposti M.
In-Text Gene Mentions

Elements of such membrane dynamics likely originated during the endosymbiosis of the alphaproteobacterial ancestor of our mitochondria but underwent an evolutionary leap forward in basal metazoa that determined the currently known variations in mitophagy signaling.<b>Abbreviations</b>: AGPAT, 1-acylglycerol-3-phosphate O-acyltransferase; ATG, autophagy related; BCL2L13, BCL2 like 13; BNIP3, BCL2 interacting protein 3; BNIP3L, BCL2 interacting protein 3 like; CALCOCO, calcium binding and coiled-coil domain; CL, cardiolipin; ER, endoplasmic reticulum; ERMES, ER-mitochondria encounter structure; FBXL4, F-box and leucine rich repeat protein 4; FUNDC1, FUN14 domain containing 1; GABARAPL1, GABA type A receptor associated protein like 1; HIF, hypoxia inducible factor; IMM, inner mitochondrial membrane; LBPA/BMP, lysobisphosphatidic acid; LIR, LC3-interacting region; LPA, lysophosphatidic acid; MAM, mitochondria-associated membranes; MAP1LC3/LC3, microtubule associated protein 1 light chain 3; MCL, monolysocardiolipin; ML, maximum likelihood; NBR1, NBR1 autophagy cargo receptor; OMM, outer mitochondrial membrane; PA, phosphatidic acid; PACS2, phosphofurin acidic cluster sorting protein 2; PC/PLC, phosphatidylcholine; PE, phosphatidylethanolamine; PHB2, prohibitin 2; PINK1, PTEN induced kinase 1; PtdIns, phosphatidylinositol; SAR, Stramenopiles, Apicomplexa and Rhizaria; TAX1BP1, Tax1 binding protein 1; ULK1, unc-51 like autophagy activating kinase 1; VDAC/porin, voltage dependent anion channel.

…ochondria encounter structure;FBXL4, F-box and leucine…

Show Full Abstract

Mitophagy is the process of selective autophagy that removes superfluous and dysfunctional mitochondria. Mitophagy was first characterized in mammalian cells and is now recognized to follow several pathways including basal forms in specific organs. Mitophagy pathways are regulated by multiple, often interconnected factors. The present review aims to streamline this complexity and evaluate common elements that may define the evolutionary origin of mitophagy. Key issues surrounding mitophagy signaling at the mitochondrial surface may fundamentally derive from mitochondrial membrane dynamics. Elements of such membrane dynamics likely originated during the endosymbiosis of the alphaproteobacterial ancestor of our mitochondria but underwent an evolutionary leap forward in basal metazoa that determined the currently known variations in mitophagy signaling.<b>Abbreviations</b>: AGPAT, 1-acylglycerol-3-phosphate O-acyltransferase; ATG, autophagy related; BCL2L13, BCL2 like 13; BNIP3, BCL2 interacting protein 3; BNIP3L, BCL2 interacting protein 3 like; CALCOCO, calcium binding and coiled-coil domain; CL, cardiolipin; ER, endoplasmic reticulum; ERMES, ER-mitochondria encounter structure; FBXL4, F-box and leucine rich repeat protein 4; FUNDC1, FUN14 domain containing 1; GABARAPL1, GABA type A receptor associated protein like 1; HIF, hypoxia inducible factor; IMM, inner mitochondrial membrane; LBPA/BMP, lysobisphosphatidic acid; LIR, LC3-interacting region; LPA, lysophosphatidic acid; MAM, mitochondria-associated membranes; MAP1LC3/LC3, microtubule associated protein 1 light chain 3; MCL, monolysocardiolipin; ML, maximum likelihood; NBR1, NBR1 autophagy cargo receptor; OMM, outer mitochondrial membrane; PA, phosphatidic acid; PACS2, phosphofurin acidic cluster sorting protein 2; PC/PLC, phosphatidylcholine; PE, phosphatidylethanolamine; PHB2, prohibitin 2; PINK1, PTEN induced kinase 1; PtdIns, phosphatidylinositol; SAR, Stramenopiles, Apicomplexa and Rhizaria; TAX1BP1, Tax1 binding protein 1; ULK1, unc-51 like autophagy activating kinase 1; VDAC/porin, voltage dependent anion channel.

DCC
Also flagged:agingABCC6pseudoxanthoma elasticumarterial calcificationENPP1calcification
Journal Article 2024-02-15 ✓ 1 Snippet Brampton C, Pomozi V, Le Corre Y, Zoll J, Kauffenstein G, Ma C, Hoffmann PR, Martin L, Le Saux O.
In-Text Gene Mentions

DCC

Show Full Abstract

Physiological calcification of soft tissues is a common occurrence in aging and various acquired and inherited disorders. ABCC6 sequence variations cause the calcification phenotype of pseudoxanthoma elasticum (PXE) as well as some cases of generalized arterial calcification of infancy, which is otherwise caused by defective ENPP1. ABCC6 is primarily expressed in the liver, which has given the impression that the liver is central to the pathophysiology of PXE/generalized arterial calcification of infancy. The emergence of inflammation as a contributor to the calcification in PXE suggested that peripheral tissues play a larger role than expected. In this study, we investigated whether bone marrow-derived ABCC6 contributes to the calcification in PXE. In Abcc6<sup>‒/‒</sup> mice, we observed prevalent mineralization in several lymph nodes and surrounding connective tissues and an extensive network of lymphatic vessels within vibrissae, a calcified tissue in Abcc6<sup>‒/‒</sup> mice. Furthermore, we found evidence of lymphangiogenesis in patients with PXE and mouse skin, suggesting an inflammatory process. Finally, restoring wild-type bone marrow in Abcc6<sup>‒/‒</sup> mice produced a significant reduction of calcification, suggesting that the liver alone is not sufficient to fully inhibit mineralization. With evidence that ABCC6 is expressed in lymphocytes, we suggest that the adaptative immune system and inflammation largely contribute to the calcification in PXE/generalized arterial calcification of infancy.

HTT
Also flagged:postpartum depressionpostnatal depressionserotoninoxytocinOXTRDepression
Journal Article 2024-02-15 ✓ 2 Snippets Chandra JH, Kurniawan C, Puspitasari IM.
In-Text Gene Mentions

The serotonin transporter (5-HTT) acts as a key mediator and therapeutic target for various diseases associated with mental disorders.34 Serotonin transporters inhibit serotonin transmission to the synaptic cleft through reuptake.34 One of the polymorphisms studied in the context of PPD is the 5 HTT-linked polymorphic region (5-HTTLPR).35 The incidence of low serotonin expression and transcriptional efficiency is associated with the short allele of 5-HTTLPR.

…serotonin transporter (5-HTT) acts as…

Show Full Abstract

Postpartum depression (PPD) is a common illness in mothers after childbirth. PPD negatively affect the mother's quality of life and the bond with the infant, which can interfere with the infant's emotional, social, and cognitive development. PPD is caused by various biological and psychosocial factors. The aim of this review is to summarize the latest evidence of the associations between genetic polymorphisms and PPD. PubMed and Scopus were used as the literature search databases for this review. The keywords used were postpartum depression, postnatal depression, genetic, and polymorphism. Twenty-seven articles were reviewed after screening and applying the inclusion criteria. As results, the serotonin gene (<i>5-HTTLPR</i>) and oxytocin genes (<i>OXTR</i>) have the most significant associations with PPD among other genes. Further research on PPD biomarkers should be conducted to diagnose and treat PPD patients.

Also flagged:fungal bone infectionsfungicidesosteogenesisbone infectionsVoriconazoleAmphotericin B
Journal Article 2024-02-15 No Snippets Bewersdorf TN, Hofmann J, Findeisen S, Schamberger C, Lingner T, Sommer U, Schmidmaier G, Grossner T.
Show Full Abstract

The treatment of fungal bone infections and infected non-unions is a huge challenge in modern trauma and orthopedics, which normally contain the local and systemic administration of anti-fungal drugs. Although frequently used, little is known about the impact of systemic and locally administered fungicides on the osteogenic regenerative capabilities of infected bone tissue, especially upon the osteogenesis of human bone marrow mesenchymal stem cells (BM-hMSCs). This study evaluates the effects of the three most common fungicides for the systemic treatment of bone infections, Voriconazole (VOR), liposomal Amphotericin B (LAMB), and Fluconazole (FLU), as well as the effects of VOR and LAMB-loaded Polymethylmethacrylate (PMMA) cement chips in different concentrations upon the osteogenic response of BM-hMSCs in vitro. Within this study, we compared the ability of BM-hMSC to differentiate into osteoblast-like cells and synthesize hydroxyapatite as assessed by radioactive <sup>99m</sup>Technetium-Hydroxydiphosphonate (<sup>99m</sup>Tc-HDP) labeling, cell proliferation, and analyses of supernatants upon various osteogenic parameters. Our results revealed that VOR added to the cell culture medium affects the osteogenic potential of BM-hMSC negatively, while there were no detectable effects of LAMB and FLU. Moreover, we showed dose-dependent negative effects of high- and extended-dose fungicide-loaded PMMA cement due to cytotoxicity, with a higher cytotoxic potential of VOR than LAMB, while low-dose fungicide-loaded PMMA had no significant effect on the osteogenic potential of BM-hMSC in vitro.

Also flagged:Polyvinylpyrrolidonesynthesiscalcium phosphatespyrophosphatetricalcium phosphatehydroxyapatite
Journal Article 2024-02-15 No Snippets Papezhuk MV, Ivanin SN, Yakupov RP, Buz'ko VY, Sukhno IV, Gneush AN, Petriev IS.
Show Full Abstract

The results of the synthesis of microcrystalline calcium phosphates such as hydroxoapatite, pyrophosphate, and tricalcium phosphate are presented herein. The influence of the addition of polyvinylpyrrolidone (PVP) on the phase characteristics of the resulting high-temperature ceramic sample is considered. The X-ray results show that hydroxyapatite (HAp) consists of a Ca<sub>5</sub>(PO<sub>4</sub>)<sub>3</sub>(OH) phase, while the sample with the addition of polyvinylpyrrolidone contains β-Ca<sub>3</sub>(PO<sub>4</sub>)<sub>2</sub> (65.5%) and β-Ca<sub>2</sub>P<sub>2</sub>O<sub>7</sub> (34.5%) phases calcium phosphates (CPs). IR spectroscopy was used to characterize the compositions of the samples. An important characteristic of the obtained samples is the elemental Ca/P ratio, which was determined via energy-dispersive analysis. The data obtained are consistent with the composition of dental enamel apatites, namely, in the CPs (1.27) and HAp (1.40). SEM was used to study the morphology of the surfaces of hydroxyapatite particles. Polyvinylpyrrolidone polymer fibers were obtained using the electroforming method with the inclusion of CPs in the composition. The fibers were oriented randomly, and nanoscale hydroxyapatite particles were incorporated into the fiber structure. Solubility data of the HAp, CPs, and Fibers in a physiological solution at room temperature and human body temperature were obtained. The solubility of the resulting HAp turned out to be higher than the solubility of the CPs. In turn, the concentration of Ca<sup>2+</sup> in a physiological solution of PVP composite fibers with the inclusion of CPs was lower than that in powdered CPs.

HTT
Also flagged:Neurological DisordersPathogenesisneurodegenerative disordersneurodegenerative diseasesamyotrophic lateral sclerosisaging
Journal Article 2024-02-15 ✓ 2 Snippets Firdaus Z, Li X.
In-Text Gene Mentions

The misfolding and aggregation of HTT disturb various cellular processes, supported by significant evidence suggesting that oligomers and/or insoluble fibrils of mHTT play a direct role in causing neurodegeneration in HD [334].

Huntington’s disease (HD) results from the expansion of a CAG repeat region in exon 1 of the huntingtin (HTT) gene, situated on chromosome 4, surpassing a pathogenic threshold of at least 37 CAGs.

Show Full Abstract

Genetic abnormalities play a crucial role in the development of neurodegenerative disorders (NDDs). Genetic exploration has indeed contributed to unraveling the molecular complexities responsible for the etiology and progression of various NDDs. The intricate nature of rare and common variants in NDDs contributes to a limited understanding of the genetic risk factors associated with them. Advancements in next-generation sequencing have made whole-genome sequencing and whole-exome sequencing possible, allowing the identification of rare variants with substantial effects, and improving the understanding of both Mendelian and complex neurological conditions. The resurgence of gene therapy holds the promise of targeting the etiology of diseases and ensuring a sustained correction. This approach is particularly enticing for neurodegenerative diseases, where traditional pharmacological methods have fallen short. In the context of our exploration of the genetic epidemiology of the three most prevalent NDDs-amyotrophic lateral sclerosis, Alzheimer's disease, and Parkinson's disease, our primary goal is to underscore the progress made in the development of next-generation sequencing. This progress aims to enhance our understanding of the disease mechanisms and explore gene-based therapies for NDDs. Throughout this review, we focus on genetic variations, methodologies for their identification, the associated pathophysiology, and the promising potential of gene therapy. Ultimately, our objective is to provide a comprehensive and forward-looking perspective on the emerging research arena of NDDs.

POU3F2
Also flagged:Sox11transcription factorsneurogenesisNeurog2Neurog1amino acids
Journal Article 2024-02-15 ✓ 5 Snippets Singleton KS, Silva-Rodriguez P, Cunningham DD, Silva EM.
In-Text Gene Mentions

Additionally, we determined that the N-terminus including the HMG domain of Sox11 is necessary for interaction with Pou3f2 and Neurog2, and we established a novel role for the N-terminal 46 amino acids in the specification of placodal progenitors.

Third, the HMG domain and the first 46 amino acids in the N-terminus are necessary for strong partner-protein interactions, whereas the C-terminus plays no role in the binding of Pou3f2 and Neurog2.

These findings indicate that the 46 amino acid N-terminus of Sox11 is required for strong partner-protein interactions with Pou3f2 and Neurog2, while the HMG domain is essential for partner-protein binding.

Collectively, our data show that the first 46 amino acids of Sox11 are required for a strong interaction with Neurog2 and Pou3f2 and formation of the posterior placodes.

…and interacts withPou3f2and Neurog2 in…

Show Full Abstract

Sox11, a member of the SoxC family of transcription factors, has distinct functions at different times in neural development. Studies in mouse, frog, chick, and zebrafish show that Sox11 promotes neural fate, neural differentiation, and neuron maturation in the central nervous system. These diverse roles are controlled in part by spatial and temporal-specific protein interactions. However, the partner proteins and Sox11-interaction domains underlying these diverse functions are not well defined. Here, we identify partner proteins and the domains of <i>Xenopus laevis</i> Sox11 required for protein interaction and function during neurogenesis. Our data show that Sox11 co-localizes and interacts with Pou3f2 and Neurog2 in the anterior neural plate and in early neurons, respectively. We also demonstrate that Sox11 does not interact with Neurog1, a high-affinity partner of Sox11 in the mouse cortex, suggesting that Sox11 has species-specific partner proteins. Additionally, we determined that the N-terminus including the HMG domain of Sox11 is necessary for interaction with Pou3f2 and Neurog2, and we established a novel role for the N-terminal 46 amino acids in the specification of placodal progenitors. This is the first identification of partner proteins for Sox11 and of domains required for partner-protein interactions and distinct roles in neurogenesis.

Also flagged:glycolic acidbone diseasesbone disorderspeptidessynthesisester
Journal Article 2024-02-15 No Snippets Hassan M, Abdelnabi HA, Mohsin S.
Show Full Abstract

Recently, nanotechnologies have become increasingly prominent in the field of bone tissue engineering (BTE), offering substantial potential to advance the field forward. These advancements manifest in two primary ways: the localized application of nanoengineered materials to enhance bone regeneration and their use as nanovehicles for delivering bioactive compounds. Despite significant progress in the development of bone substitutes over the past few decades, it is worth noting that the quest to identify the optimal biomaterial for bone regeneration remains a subject of intense debate. Ever since its initial discovery, poly(lactic-co-glycolic acid) (PLGA) has found widespread use in BTE due to its favorable biocompatibility and customizable biodegradability. This review provides an overview of contemporary advancements in the development of bone regeneration materials using PLGA polymers. The review covers some of the properties of PLGA, with a special focus on modifications of these properties towards bone regeneration. Furthermore, we delve into the techniques for synthesizing PLGA nanoparticles (NPs), the diverse forms in which these NPs can be fabricated, and the bioactive molecules that exhibit therapeutic potential for promoting bone regeneration. Additionally, we addressed some of the current concerns regarding the safety of PLGA NPs and PLGA-based products available on the market. Finally, we briefly discussed some of the current challenges and proposed some strategies to functionally enhance the fabrication of PLGA NPs towards BTE. We envisage that the utilization of PLGA NP holds significant potential as a potent tool in advancing therapies for intractable bone diseases.

TNFSF4
Also flagged:LDL receptor related protein 11LRP11LDL lipoprotein receptor-related protein 11tumorshepatocellular carcinomaliver hepatocellular carcinoma
Journal Article 2024-02-15 ✓ 4 Snippets Yoo W, Kim AK, Kook HU, Noh K.
In-Text Gene Mentions

…CCL25 on chemokine,TNFSF4, PVR, and IL6R…

…CD274, CD200, CD86,TNFSF4, HAVCR2, LAIR1, CD28,…

…of TAP1, CCL28,TNFSF4, TGFBR1, and CCR10…

…of TAP1 andTNFSF4were risk factors…

Show Full Abstract

LDL lipoprotein receptor-related protein 11 (LRP11) plays a role in several tumors. However, their roles in hepatocellular carcinoma remain unclear. The present study aimed to explore the expression profile and prognostic value of LRP11 in liver hepatocellular carcinoma (LIHC) patients using various cancer databases and bioinformatic tools. In bioinformatics analysis, The Cancer Genome Atlas datasets showed increased LRP11 expression in tumor tissues compared to that in non-tumor tissues in various cancers. Moreover, patients with high expression LRP11 correlated with poor prognosis and clinical features. The LRP11 expression positively correlated with the infiltration of immune cells such as macrophages, neutrophils, and myeloid-derived suppressor cells and a combination of high LRP11 expression and high immune infiltrates was associated with the worst survival in LIHC tumors. Our results also indicated that LRP11 expression was closely associated with immune-modulate function, such as antigen presentation. In DNA methylation profiling, hypomethylation of LRP11 is widely observed in tumors and has prognostic value in LIHC patients. Functional enrichment analysis revealed that LIHC-specific LRP11 interacting genes are involved in protein binding, intracellular processing, and G-protein-related signaling pathways. Analyses of drug sensitivity and immune checkpoint inhibitor predict a number of drugs that could potentially be used to target LRP11. In addition, <i>in vitro</i> experiments verified the promoting effect of LRP11 on the migration, invasion, and colony formation capacity of hepatocellular carcinoma cells. Collectively, our results aided a better understanding of the clinical significance of LRP11 in gene expression, functional interactions, and epigenetic regulation in LIHC and suggested that it may be a useful prognostic biomarker for LIHC patients.

BTN2A1
Also flagged:MHCtumorantigen presentationcytokineantibodyIFN-γ
Journal Article 2024-02-15 ✓ 3 Snippets Verkerk T, Pappot AT, Jorritsma T, King LA, Duurland MC, Spaapen RM, van Ham SM.
In-Text Gene Mentions

Immunotherapy based on γδ T cells involves in vivo stimulation of Vδ2 T cells through intravenous administration of pamidronate or zoledronate, which are bisphosphonates stimulating the conformational change of the BTN3A1/BTN2A1 complex, and autologous or allogenic reinfusion of ex vivo zoledronate driven expanded γδ T cells (3, 15, 40–42).

…the butyrophilin (BTN) BTN3A1/BTN2A1complex, modulated by…

…change of the BTN3A1/BTN2A1complex, and autologous…

Show Full Abstract

γδ T cells are important components of the immune system due to their ability to elicit a fast and strong response against infected and transformed cells. Because they can specifically and effectively kill target cells in an MHC independent fashion, there is great interest to utilize these cells in anti-tumor therapies where antigen presentation may be hampered. Since only a small fraction of T cells in the blood or tumor tissue are γδ T cells, they require extensive expansion to allow for fundamental, preclinical and <i>ex vivo</i> research. Although expansion protocols can be successful, most are based on depletion of other cell types rather than γδ T cell specific isolation, resulting in unpredictable purity of the isolated fraction. Moreover, the primary focus only lies with expansion of Vδ2<sup>+</sup> T cells, while Vδ1<sup>+</sup> T cells likewise have anti-tumor potential. Here, we investigated whether γδ T cells directly isolated from blood could be efficiently expanded while maintaining function. γδ T cell subsets were isolated using MACS separation, followed by FACS sorting, yielding >99% pure γδ T cells. Isolated Vδ1<sup>+</sup> and Vδ2<sup>+</sup> T cells could effectively expand immediately after isolation or upon freeze/thawing and reached expansion ratios between 200 to 2000-fold starting from varying numbers using cytokine supported feeder stimulations. MACS/FACS isolated and PHA stimulated γδ T cells expanded as good as immobilized antibody mediated stimulated cells in PBMCs, but delivered purer cells. After expansion, potential effector functions of γδ T cells were demonstrated by IFN-γ, TNF-α and granzyme B production upon PMA/ionomycin stimulation and effective killing capacity of multiple tumor cell lines was confirmed in killing assays. In conclusion, pure γδ T cells can productively be expanded while maintaining their anti-tumor effector functions against tumor cells. Moreover, γδ T cells could be expanded from low starting numbers suggesting that this protocol may even allow for expansion of cells extracted from tumor biopsies.

Also flagged:strokeatrial fibrillationischemic strokeAFalcoholheart failure
Journal Article 2024-02-15 No Snippets Lim WH, Lee SR, Choi EK, Lee SW, Han KD, Oh S, Lip GYH.
Show Full Abstract

<h4>Background</h4>The impact of early rhythm control (ERC) combined with healthy lifestyle (HLS) on the risk of ischemic stroke in elderly patients with atrial fibrillation (AF) remains unaddressed.<h4>Objective</h4>To evaluate the impact of combined ERC and HLS on the risk of stroke in elderly patients with new-onset AF.<h4>Methods</h4>Using the Korean National Health Insurance Service database, we included patients aged ≥75 years with new-onset AF from January 2009 to December 2016 (<i>n</i> = 41,315). Patients who received rhythm control therapy within 2 years of AF diagnosis were defined as the ERC group. Non-smoking, non-to-mild alcohol consumption (<105 g/week), and regular exercise were defined as HLS. Subjects were categorized into four groups: group 1 (without ERC and HLS, <i>n</i> = 25,093), 2 (HLS alone, <i>n</i> = 8,351), 3 (ERC alone, <i>n</i> = 5,565), and 4 (both ERC and HLS, <i>n</i> = 2,306). We assessed the incidence of ischemic stroke as the primary outcome, along with admissions for heart failure, all-cause death, and the composite of ischemic stroke, admission for heart failure, and all-cause death.<h4>Results</h4>Median follow-up duration of the study cohort was 3.4 years. After adjusting for multiple variables, groups 2 and 3 were associated with a lower stroke risk (adjusted hazard ratio [aHR]: 95% confidence interval [CI]: 0.867, 0.794-0.948 and 0.713, 0.637-0.798, respectively) than that of group 1. Compared to Group 1, group 4 showed the lowest stroke risk (aHR: 0.694, 95% CI: 0.586-0.822) among all groups, followed by group 3 (0.713, 0.637-0.798) and group 2 (0.857, 0.794-0.948), respectively. Group 4 was associated with the lowest risk of all-cause death (aHR: 0.680, 95% CI: 0.613-0.754) and the composite outcome (aHR: 0.708, 95% CI: 0.649-0.772).<h4>Conclusion</h4>ERC and HLS were associated with a lower risk of ischemic stroke in elderly patients with new-onset AF. Concurrently implementing ERC and maintaining HLS was associated with the lowest risk of death and the composite outcome, with a modest synergistic effect on stroke prevention.

SERPINC1
Also flagged:influenza virus infectioncoronary heart diseasesevere acute respiratory syndromeSOCS1interferonIFN
Journal Article 2024-02-15 ✓ 1 Snippet Xing Y, Chen L, Hu B, Li Y, Mai H, Li G, Han S, Wang Y, Huang Y, Tian Y, Zhang W, Gao Y, He H.
In-Text Gene Mentions

…a decline inantithrombin-IIIfunction, thereby creating…

Show Full Abstract

Patients with pre-existing medical conditions are at a heightened risk of contracting severe acute respiratory syndrome (SARS), SARS-CoV-2, and influenza viruses, which can result in more severe disease progression and increased mortality rates. Nevertheless, the molecular mechanism behind this phenomenon remained largely unidentified. Here, we found that microRNA-19a/b (miR-19a/b), which is a constituent of the miR-17-92 cluster, exhibits reduced expression levels in patients with coronary heart disease in comparison to healthy individuals. The downregulation of miR-19a/b has been observed to facilitate the replication of influenza A virus (IAV). miR-19a/b can effectively inhibit IAV replication by targeting and reducing the expression of SOCS1, as observed in cell-based and coronary heart disease mouse models. This mechanism leads to the alleviation of the inhibitory effect of SOCS1 on the interferon (IFN)/JAK/STAT signaling pathway. The results indicate that the IAV employs a unique approach to inhibit the host's type I IFN-mediated antiviral immune responses by decreasing miR-19a/b. These findings provide additional insights into the underlying mechanisms of susceptibility to flu in patients with coronary heart disease. miR-19a/b can be considered as a preventative/therapy strategy for patients with coronary heart disease against influenza virus infection.

HFE
Also flagged:irondicalcium phosphatephosphatescalcium carbonatephosphoric aciddicalcium
Journal Article 2024-02-15 ✓ 1 Snippet Feijo JC, Vieira SL, Maria DDB, Horn RM, Favero A, Altevogt WE, Nicola BS.
In-Text Gene Mentions

…as usual inhemochromatosis( Fleming and…

Show Full Abstract

Iron is routinely supplemented in broiler feeds aiming to prevent dietary deficiencies. Limestone and phosphates are very rich in Fe; however, its contribution from these sources have not been thoroughly investigated with chickens. The present research was conducted to evaluate live performance and blood parameters of broilers when using limestone and dicalcium phosphate as sources of Fe. A total of 576 one-day-old male Cobb x Cobb 500 were allocated into a total of 72 battery cages, 6 treatments with 12 replication cages of 8 chicks at placement. Chicks were fed diets formulated with corn, soybean meal (SBM) with laboratory grade calcium carbonate and phosphoric acid (having traces of Fe). All chicks were fed a common prestarter without Fe supplementation (analyzed total 58.2 ± 2.4 mg/kg Fe) from placement to 7 d. Allocation of birds to dietary treatments was completely randomized on day 8. Treatments had increasing Fe derived from commercial limestone and dicalcium phosphate (analyzed Fe 7,218 and 4,783 mg/kg, respectively) progressively replacing calcium carbonate and phosphoric acid to provide graded increases in total Fe (analyzed Fe in the feeds were 57.6 ± 2.1, 92.0 ± 2.3, 124.1 ± 2.7, 159.3 ± 3.1, 187.2 ± 3.2, 223.7 ± 3.6 mg/kg, respectively). There were no effects of dietary Fe on live performance, hematocrit, and hemoglobin the end of the study on day 28 (P > 0.05). Increasing dietary Fe from commercial limestone and dicalcium phosphate led to a linear reduction in the percent ileal digestible Fe. However, linear increments in Fe retention, serum ferritin and liver Fe occurred when compared to feeds without Fe derived from limestone and phosphate dicalcium. It is concluded that Fe from limestone and dicalcium phosphate can be partially utilized by broiler chickens. It was estimated that the Fe retained from limestone and dicalcium phosphate is of 1.9%. Broilers fed corn-soy feeds (58.2 mg/kg Fe) do not require supplemental Fe.

HFE
Also flagged:infertilityinseminationovulationfertilizationtubal blockagepremature ovarian insufficiency
Journal Article 2024-02-15 ✓ 1 Snippet Malhotra J, Devi MG, Patil M.
In-Text Gene Mentions

…othalamus, hyperprolactinemia,hemochromatosis, Kallmann syndrome, and…

Show Full Abstract

<h4>Aim</h4>The objective of this document is to provide guidance to the infertility specialist, gynecologist, embryologist, and counselors on the management of sub-fertility and brief them with the recent advances in the field. These recommendations will aid the aforementioned healthcare professionals in everyday clinical decisions about appropriate and effective care of their patients with the best available evidence.<h4>Participants</h4>Extensive deliberations, discussion, and brainstorming was done between different reproductive medicine (RM) specialists, to develop the recommendations.<h4>Evidence</h4>A systematic review of the literature published up to June 2019 was carried out using PubMed and Cochrane Collaboration Library. International guidelines, cohort studies, case series, observational studies, and randomized controlled trials currently available in the literature were reviewed. Indian data whatever available was also reviewed.<h4>Process</h4>Primary meetings were held with leading reproductive medicine specialists. Each topic was brainstormed on by a group of reproductive medicine experts, who then prepared the first draft of the recommendation. These recommendations then were reviewed by Dr. Jaideep Malhotra, Dr. Gouri Devi, and Dr. Madhuri Patil along with the chief co-ordinator of each consensus to finalize the final draft.<h4>Conclusions</h4>From the literature and discussion of the available evidence, several topics were identified for which evidence is inconsistent, insufficient, or non-existing. For the benefit of couples undergoing several treatments, the working committee recommends that future research, where possible in well-designed RCTs, will help in establishing evidence for a particular practice. In the Indian context, one also needs to take into consideration facilities and options available, cost, lack of insurance coverage, experimental nature of some advanced techniques used.

HTT
Also flagged:psilocybindepressionserotonin receptors5-hydroxytryptaminepsilocinserotonin receptor
Journal Article 2024-02-15 ✓ 1 Snippet Vohryzek J, Cabral J, Lord LD, Fernandes HM, Roseman L, Nutt DJ, Carhart-Harris RL, Deco G, Kringelbach ML.
In-Text Gene Mentions

…the 5-HT transporter (5-HTT; Spearman’s ρ =…

Show Full Abstract

Psilocybin therapy for depression has started to show promise, yet the underlying causal mechanisms are not currently known. Here, we leveraged the differential outcome in responders and non-responders to psilocybin (10 and 25 mg, 7 days apart) therapy for depression-to gain new insights into regions and networks implicated in the restoration of healthy brain dynamics. We used large-scale brain modelling to fit the spatiotemporal brain dynamics at rest in both responders and non-responders before treatment. Dynamic sensitivity analysis of systematic perturbation of these models enabled us to identify specific brain regions implicated in a transition from a depressive brain state to a healthy one. Binarizing the sample into treatment responders (>50% reduction in depressive symptoms) versus non-responders enabled us to identify a subset of regions implicated in this change. Interestingly, these regions correlate with <i>in vivo</i> density maps of serotonin receptors 5-hydroxytryptamine 2a and 5-hydroxytryptamine 1a, which psilocin, the active metabolite of psilocybin, has an appreciable affinity for, and where it acts as a full-to-partial agonist. Serotonergic transmission has long been associated with depression, and our findings provide causal mechanistic evidence for the role of brain regions in the recovery from depression via psilocybin.

bioRxiv 2024-02-15 Preprint (No Snippets API) Möbus L, Serra A, Fratello M, Pavel A, Federico A, Greco D.
Show Full Abstract

The categorization of human diseases is mainly based on the affected organ system and phenotypic characteristics. This is limiting the view to the pathological manifestations, while it neglects mechanistic relationships that are crucial to develop therapeutic strategies. This work aims to advance the understanding of diseases and their relatedness beyond traditional phenotypic views. Hence, the similarity among 502 diseases is mapped using six different data dimensions encompassing molecular, clinical, and pharmacological information retrieved from public sources. Multiple distance measures and multi-view clustering is used to assess the patterns of disease relatedness. The integration of all six dimensions into a consensus map of disease relationships reveals a divergent disease view from the International Classification of Diseases (ICD), emphasizing novel insights offered by a multi-view disease map. Disease features such as genes, pathways, and chemicals that are enriched in distinct disease groups are identified. Finally, an evaluation of the top similar diseases of three candidate diseases common in the Western population shows concordance with known epidemiological associations and reveals rare features shared between Type 2 diabetes and Alzheimer disease. A revision of disease relationships holds promise for facilitating the reconstruction of comorbidity patterns, repurposing drugs, and advancing drug discovery in the future.

medRxiv 2024-02-15 Preprint (No Snippets API) Elgaeva EE, Zorkoltseva IV, Nostaeva AV, Verzun DA, Tiys ES, Timoshchuk AN, Kirichenko AV, Svishcheva GR, Freidin MB, Williams FMK, Suri P, Aulchenko YS, Axenovich TI, Tsepilov YA.
Show Full Abstract

Chronic back pain (CBP) is a disabling condition with a lifetime prevalence of 40% and a substantial socioeconomic burden. Because of the high heterogeneity of CBP, subphenotyping may be necessary to improve prediction and support personalized treatment for those with CBP. The lack of distinct cellular and molecular markers for CBP complicates the task of subphenotyping. To investigate CBP subphenotypes, we decomposed the genetic background of CBP into a shared genetic background common to other chronic pain conditions (back, neck, hip, knee, stomach, and head pain) and unshared genetic background related only to CBP. We showed that the shared and unshared genetic backgrounds of CBP differ in their biological functions: the first one is likely to control processes mainly in nervous, immune and musculoskeletal systems underlying chronic pain development regardless its site, while the second may contribute more to local processes in spine leading to chronic pain precisely in the back. We identified 18 genes with shared impact across different chronic pain conditions and two genes that were specific for CBP. These findings may contribute to future development of targets and new biomarkers for chronic pain management. Next, among people with CBP, we demonstrated that polygenic risk scores accounting for the shared and unshared genetic backgrounds of CBP may underpin different subphenotypes of CBP cases. These subphenotypes are characterized by varying genetic predisposition to a wide array of medical conditions and interventions such as diabetes mellitus, myocardial infarction, diagnostic endoscopic procedures, and surgery involving muscles, bones, and joints. The proposed genetic decomposition framework holds promise for investigating the genetic underpinnings of other heterogeneous diseases. <h4>Author Summary</h4> Chronic back pain (CBP) is a prevalent disabling health problem with heterogeneous clinical presentation and natural history. This may contribute to generic pain treatment approaches not sufficiently effective when prescribed for patients with certain characteristics. Development of more personalized treatment is needed, and may benefit from a deep understanding of CBP biology, such as genomics. It is known that chronic pain is under the control of both environmental and genetic background. Here we applied bioinformatic methods to study the genetic background of CBP decomposed into two parts: a shared one common to six distinct chronic pain types, and unshared, which is specific to CBP. This approach allowed us to identify more genes potentially involved in CBP development. Among them 18 belong to the shared genetic background contributing to development of chronic pain in general, and two are specific for CBP. We demonstrate that these two parts of the genetic background of CBP are associated with distinct biological pathways and underlie predisposition to different medical states and procedures, involving diabetes, myocardial infarction, and musculoskeletal surgery. Decomposition of CBP genetic background into shared and unshared may provide a better understanding of mechanisms of CBP and facilitate development of personalized pain treatment.

medRxiv 2024-02-15 Preprint (No Snippets API) Soheili-Nezhad S, Schijven D, Mars RB, Fisher SE, Francks C.
Show Full Abstract

Dyslexia is a common condition that impacts reading ability. Identifying affected brain networks has been hampered by limited sample sizes of imaging case-control studies. We focused instead on brain structural correlates of genetic disposition to dyslexia in large-scale population data. In over 30,000 adults (UK Biobank), higher polygenic disposition to dyslexia was associated with lower head and brain size, and especially reduced volume and/or altered fiber density in networks involved in motor control, language and vision. However, individual genetic variants disposing to dyslexia often had quite distinct patterns of association with brain structural features. Independent component analysis applied to brain-wide association maps for thousands of dyslexia-disposing genetic variants revealed multiple impact modes on the brain, that corresponded to anatomically distinct areas with their own genomic profiles of association. Polygenic scores for dyslexia-related cognitive and educational measures, as well as attention-deficit/hyperactivity disorder, showed similarities to dyslexia polygenic disposition in terms of brain-wide associations, with microstructure of the internal capsule consistently implicated. In contrast, lower volume of the primary motor cortex was only associated with higher dyslexia polygenic disposition among all traits. These findings robustly reveal heterogeneous neurobiological aspects of dyslexia genetic disposition, and whether they are shared or unique with respect to other genetically correlated traits.

Synthetic autophagy receptor.

HTT
Also flagged:autophagosomesmembraneautophagy receptorsLC3GABARAPSQSTM1
Journal Article 2024-02-14 ✓ 1 Snippet Jiang Z, Kuo YH, Arkin MR.
In-Text Gene Mentions

HTT

Show Full Abstract

Macroautophagy/autophagy receptors target their substrates to phagophores for subsequent sequestration within autophagosomes. During phagophore membrane expansion in mammalian cells, autophagy receptors simultaneously interact with the ubiquitinated substrates and the LC3/GABARAP proteins on the expanding membrane. In this punctum, we summarize and discuss our recent research progress on synthetic autophagy receptors (AceTACs). The series of AceTACs were designed by engineering the essential interacting domains and motifs of SQSTM1/p62 (sequestosome 1), a major mammalian autophagy receptor. Particularly, we replaced the ubiquitin-associated domain of SQSTM1 with a target-specific antibody, redirecting the bifunctional interactions of wild-type SQSTM1 and directing the degradation target into the autophagy process. We successfully demonstrated the targeted degradation of aggregation-prone proteins using the AceTAC degraders. Moreover, we presented a model system with a guideline to induce targeted degradation of organelles through the autophagy machinery.

HFE
Also flagged:scleredema adultorumimmunoglobulinmycophenolate mofetilconnective tissue disordersscleredemascleroderma
Journal Article 2024-02-14 ✓ 1 Snippet Pournazari M, Mohamadzadeh D, Assar S, Ramezani M.
In-Text Gene Mentions

…bacterial infections precedingscleredema type 1type 1, treatment…

Show Full Abstract

<h4>Background</h4>Scleredema adultorum of Buschke is a rare disease characterized by firm and non-pitting edema of the skin. The condition is rare with unknown etiology. Diagnosis is made on the basis of clinical findings and skin biopsy.<h4>Case presentation</h4>Here, we describe a 14-year-old Iranian girl presenting with non-pitting edema and woody thickening of the skin that progressed within a month. She was evaluated for possible underlying malignancy or connective tissue disorders, which were excluded by multiple laboratory workups. She underwent a skin biopsy which confirmed the diagnosis of scleredema, and she was successfully treated with intravenous immunoglobulin and mycophenolate mofetil.<h4>Conclusion</h4>While scleredema adultorum of Buschke is a rare disease with no definite treatment, our effort through this report was to highlight the possible benefits of treatment by intravenous immunoglobulin and mycophenolate mofetil.

Also flagged:depressionmental illnessesgene expressionnoradrenalinemental illnesslocalization
Journal Article 2024-02-14 No Snippets Li J, Wang D, Xia J, Zhang C, Meng Y, Xu S, Chen H, Liao W.
Show Full Abstract

Individuals with depression have the highest lifetime prevalence of suicide attempts (SA) among mental illnesses. Numerous neuroimaging studies have developed biomarkers from task-related neural activation in depressive patients with SA, but the findings are inconsistent. Empowered by the contemporary interconnected view of depression as a neural system disorder, we sought to identify a specific brain circuit utilizing published heterogeneous neural activations. We systematically reviewed all published cognitive and emotional task-related functional MRI studies that investigated differences in the location of neural activations between depressive patients with and without SA. We subsequently mapped an underlying brain circuit functionally connecting to each experimental activation using a large normative connectome database (n = 1000). The identified SA-related functional network was compared to the network derived from the disease control group. Finally, we decoded this convergent functional connectivity network using microscale transcriptomic and chemo-architectures, and macroscale psychological processes. We enrolled 11 experimental tasks from eight studies, including depressive patients with SA (n = 147) and without SA (n = 196). The heterogeneous SA-related neural activations localized to the somato-cognitive action network (SCAN), exhibiting robustness to little perturbations and specificity for depression. Furthermore, the SA-related functional network was colocalized with brain-wide gene expression involved in inflammatory and immunity-related biological processes and aligned with the distribution of the GABA and noradrenaline neurotransmitter systems. The findings demonstrate that the SA-related functional network of depression is predominantly located at the SCAN, which is an essential implication for understanding depressive patients with SA.

NEGR1
Also flagged:Renal DiseasePulmonary HypertensionSickle cell diseasehemolytic anemiaSickle cell disease nephropathyinsulin-like growth factor-binding protein 6
Journal Article 2024-02-14 ✓ 2 Snippets Garrett ME, Foster MW, Telen MJ, Ashley-Koch AE.
In-Text Gene Mentions

neuronal growth regulator 1

NEGR1

Show Full Abstract

Sickle cell disease (SCD) is characterized by red blood cell sickling, vaso-occlusion, hemolytic anemia, damage to multiple organ systems, and, as a result, shortened life expectancy. Sickle cell disease nephropathy (SCDN) and pulmonary hypertension (pHTN) are common and frequently co-occurring complications of SCD; both are associated with markedly accelerated mortality. To identify candidate circulating biomarkers of SCDN and pHTN, we used mass spectrometry to quantify the relative abundance of >1000 proteins in plasma samples from 189 adults with SCD from the Outcome Modifying Genes in SCD (OMG-SCD) cohort (ProteomeXchange identifier PXD048716). Forty-four proteins were differentially abundant in SCDN, most significantly cystatin-C and collagen α-1(XVIII) chain (COIA1), and 55 proteins were dysregulated in patients with SCDN and pHTN, most significantly insulin-like growth factor-binding protein 6 (IBP6). Network analysis identified a module of 133 coregulated proteins significantly associated with SCDN, that was enriched for extracellular matrix proteins, insulin-like growth factor binding proteins, cell adhesion proteins, EGF-like calcium binding proteins, and several cadherin family members. Collectively, these data provide a comprehensive understanding of plasma protein changes in SCDN and pHTN which validate numerous studies of chronic kidney disease and suggest shared profiles of protein disruption in kidney dysfunction and pHTN among SCD patients.

Also flagged:Synthesisspinal cord injurieshydroxyapatitebindingsinfectionaxons
Journal Article 2024-02-14 No Snippets Afraei F, Daneshjou S, Dabirmanesh B.
Show Full Abstract

The bacterial enzyme chondroitinase ABCI (chABCI), which has been isolated from Proteus Vulgaris, is crucial in the treatment of spinal cord injuries. However, due to its short lifespan, the maintenance and clinical application of this enzyme are very constrained. In this study, the immobilization of this enzyme on hydroxyapatite has been carried out and assessed with the aim of enhancing the characteristics and efficiency of chABCI. Hydroxyapatite particles (HAPs) are a potential candidate for drug-delivery carriers because of their excellent biocompatibility, shape controllability, and high adsorption. The use of the nanometer scale allows efficient access to the enzyme's substrate. It demonstrates important biological application capabilities in this way. Field emission gun-scanning electron microscopy (FEG-SEM), X-ray diffraction (XRD), infrared spectroscopy (FT-IR), in vitro release study, and cytotoxicity test were used to characterize the drug nanosystem's properties. According to the findings, electrostatic bindings was formed between charged groups of the enzyme and hydroxyapatite nanoparticles. The results also demonstrated that immobilized chABCI on hydroxyapatite has beneficial properties, such as more manageable drug release, minimal toxicity and side effects, and a high potential to enhance the efficacy of drug delivery and decrease the need for repeated injections.

PRDX6
Also flagged:TumorTP53tumor suppressorbreast cancersHER2breast cancer
Journal Article 2024-02-14 ✓ 5 Snippets Dibra D, Xiong S, Moyer SM, El-Naggar AK, Qi Y, Su X, Kong EK, Korkut A, Lozano G.
In-Text Gene Mentions

NRF2 inhibition with either brusatol or luteolin reduced Mgst3 and Prdx6 transcripts in both murine and human mutant p53 cells (Fig. 6D and fig.

Both mutant p53R245W and NRF2 were present at two ARE sites in the Prdx6 promoter in P245CC tumor cells but not the respective mutant p53-deleted clone (Fig. 6, J and K).

Short hairpin knockdown of MGST3 (~70% reduction) had minimal effects on tumor establishment and growth; meanwhile, complete knockdown of PRDX6 (~98%) impeded tumor establishment when low (0.5 × 106) or high (3 × 106) number of cancer cells was implanted in vivo (Fig. 5C and fig.

…of Mgst3 andPrdx6, which encode…

…of Mgst3 andPrdx6, P 245 CC…

Show Full Abstract

The <i>TP53</i> tumor suppressor gene is mutated early in most of the patients with triple-negative breast cancer (TNBC). The most frequent <i>TP53</i> alterations are missense mutations that contribute to tumor aggressiveness. Here, we used an autochthonous somatic TNBC mouse model, in which mutant p53 can be toggled on and off genetically while leaving the tumor microenvironment intact and wild-type for p53 to identify physiological dependencies on mutant p53. In TNBCs that develop in this model, deletion of two different hotspot p53R172H and p53R245W mutants triggers ferroptosis in vivo, a cell death mechanism involving iron-dependent lipid peroxidation. Mutant p53 protects cells from ferroptosis inducers, and ferroptosis inhibitors reverse the effects of mutant p53 loss in vivo. Single-cell transcriptomic data revealed that mutant p53 protects cells from undergoing ferroptosis through NRF2-dependent regulation of <i>Mgst3</i> and <i>Prdx6</i>, which encode two glutathione-dependent peroxidases that detoxify lipid peroxides. Thus, mutant p53 protects TNBCs from ferroptotic death.

Also flagged:Synthesismetalateanionstransition metalatetransition metalatescarbonyls
Journal Article 2024-02-14 No Snippets Landaeta VR, Horsley Downie TM, Wolf R.
Show Full Abstract

This review surveys the synthesis and reactivity of low-oxidation state metalate anions of the d-block elements, with an emphasis on contributions reported between 2006 and 2022. Although the field has a long and rich history, the chemistry of transition metalate anions has been greatly enhanced in the last 15 years by the application of advanced concepts in complex synthesis and ligand design. In recent years, the potential of highly reactive metalate complexes in the fields of small molecule activation and homogeneous catalysis has become increasingly evident. Consequently, exciting applications in small molecule activation have been developed, including in catalytic transformations. This article intends to guide the reader through the fascinating world of low-valent transition metalates. The first part of the review describes the synthesis and reactivity of d-block metalates stabilized by an assortment of ligand frameworks, including carbonyls, isocyanides, alkenes and polyarenes, phosphines and phosphorus heterocycles, amides, and redox-active nitrogen-based ligands. Thereby, the reader will be familiarized with the impact of different ligand types on the physical and chemical properties of metalates. In addition, ion-pairing interactions and metal-metal bonding may have a dramatic influence on metalate structures and reactivities. The complex ramifications of these effects are examined in a separate section. The second part of the review is devoted to the reactivity of the metalates toward small inorganic molecules such as H<sub>2</sub>, N<sub>2</sub>, CO, CO<sub>2</sub>, P<sub>4</sub> and related species. It is shown that the use of highly electron-rich and reactive metalates in small molecule activation translates into impressive catalytic properties in the hydrogenation of organic molecules and the reduction of N<sub>2</sub>, CO, and CO<sub>2</sub>. The results discussed in this review illustrate that the potential of transition metalate anions is increasingly being tapped for challenging catalytic processes with relevance to organic synthesis and energy conversion. Therefore, it is hoped that this review will serve as a useful resource to inspire further developments in this dynamic research field.

HFE
Also flagged:ironiron deficiencyHereditary hemochromatosisHHDysmetabolic iron overload syndromeDIOS
Journal Article 2024-02-14 ✓ 3 Snippets Lobbes H, Dalle C, Pereira B, Ruivard M, Mazur A, Gladine C.
In-Text Gene Mentions

…(p.Cys.282.Tyr) in theHFEgene promoting massive…

…mutation in theHFEgene.…

…iron in homozygousHFEpatients was recently…

Show Full Abstract

<h4>Introduction</h4>Oxylipins are mediators of oxidative stress. To characterize the underlying inflammatory processes and phenotype effect of iron metabolism disorders, we investigated the oxylipin profile in hereditary hemochromatosis (HH) and dysmetabolic iron overload syndrome (DIOS) patients.<h4>Methods</h4>An LC-MS/MS-based method was performed to quantify plasma oxylipins in 20 HH and 20 DIOS patients in fasting conditions and 3 h after an iron-rich meal in HH patients.<h4>Results</h4>Principal component analysis showed no separation between HH and DIOS, suggesting that the clinical phenotype has no direct impact on oxylipin metabolism. 20-HETE was higher in DIOS and correlated with hypertension (p = 0.03). Different oxylipin signatures were observed in HH before and after the iron-rich meal. Discriminant oxylipins include epoxy fatty acids derived from docosahexaenoic acid and arachidonic acid as well as 13-HODE and 9-HODE. Mediation analysis found no major contribution of dietary iron absorption for 16/22 oxylipins significantly affected by the meal.<h4>Discussion</h4>The oxylipin profiles of HH and DIOS seemed similar except for 20-HETE, possibly reflecting different hypertension prevalence between the two groups. Oxylipins were significantly affected by the iron-rich meal, but the specific contribution of iron was not clear. Although iron may contribute to oxidative stress and inflammation in HH and DIOS, this does not seem to directly affect oxylipin metabolism.

HFE
Also flagged:heart failureangiotensin receptorneprilysinsodium-glucose cotransporter 2sacubitrilvalsartan
Journal Article 2024-02-14 ✓ 2 Snippets Shiraishi Y, Ikemura N, Urashima M, Kohno T, Nakano S, Tanaka T, Nagatomo Y, Ikoma T, Ono T, Numasawa Y, Sakamoto M, Nishikawa K, Takei M, Hakuno D, Nakamaru R, Ueda I, Kohsaka S.
In-Text Gene Mentions

…is considered anHFEonly if worsening…

…glomerular filtration ratio;HFE, heart failure event;…

Show Full Abstract

<h4>Introduction</h4>The current guidelines strongly recommend early initiation of multiple classes of cardioprotective drugs for patients with heart failure with reduced ejection fraction to improve prognosis and health status. However, evidence on the optimal sequencing of approved drugs is scarce, highlighting the importance of individualised treatment plans. Registry data indicate that only a portion of these patients can tolerate all four recommended classes, underscoring the need to establish the favoured sequence when using these drugs. Additionally, the choice between long-acting and short-acting loop diuretics in the present era remains uncertain. This is particularly relevant given the frequent use of angiotensin receptor-neprilysin inhibitor and sodium-glucose cotransporter 2 inhibitor, both of which potentiate natriuretic effects.<h4>Methods and analysis</h4>In a prospective, randomised, open-label, blinded endpoint method, LAQUA-HF (Long-acting vs short-acting diuretics and neurohormonal Agents on patients' QUAlity-of-life in Heart Failure patients) will be a 2×2 factorial design, with a total of 240 patients randomised to sacubitril/valsartan versus dapagliflozin and torsemide versus furosemide in a 1:1 ratio. Most enrolment sites have participated in an ongoing observational registry for consecutive patients hospitalised for heart failure involved dedicated study coordinators, and used the same framework to enrol patients. The primary endpoint is the change in patients' health status over 6 months, defined by the Kansas City Cardiomyopathy Questionnaire. Additionally, clinical benefit at 6 months defined as a hierarchical composite endpoint will be assessed by the win ratio as the secondary endpoint.<h4>Ethics and dissemination</h4>The medical ethics committee Keio University in Japan has approved this trial. All participants provide written informed consent prior to study entry. The results of this trial will be disseminated in one main paper and additional papers on secondary endpoints and subgroup analyses.<h4>Trial registration number</h4>UMIN000045229.

Also flagged:sleepbrainmental health disordersanxietydepressiontryptophan
Journal Article 2024-02-14 No Snippets Patterson E, Tan HTT, Groeger D, Andrews M, Buckley M, Murphy EF, Groeger JA.
Show Full Abstract

Stress and sleep are linked with overall well-being. Bifidobacterium longum 1714 has been shown to influence stress responses and modulate neural responses during social stress, and influence sleep quality during examination stress in healthy adults. Here, we explored the ability of this strain to alter sleep quality in adults using subjective and objective measures. Eighty-nine adults (18-45y) with impaired sleep quality assessed with the Pittsburgh Sleep Quality Index (PSQI) and with a global score ≥ 5 were randomized to receive B. longum 1714 or placebo daily for eight weeks. Assessing the effect of the strain on PSQI global score was the primary objective. Secondary objectives assessed sleep quality and well-being subjectively and sleep parameters using actigraphy objectively. While PSQI global score improved in both groups, B. longum 1714 significantly improved the PSQI component of sleep quality (p < 0.05) and daytime dysfunction due to sleepiness (p < 0.05) after 4 weeks and social functioning (p < 0.05) and energy/vitality (p < 0.05) after 8 weeks, compared to placebo. No significant effect on actigraphy measures were observed. The 1714 strain had a mild effect on sleep, demonstrated by a faster improvement in sleep quality at week 4 compared to placebo, although overall improvements after 8 weeks were similar in both groups. B. longum 1714 improved social functioning and increased energy/vitality in line with previous work that showed the strain modulated neural activity which correlated with enhanced vitality/reduced mental fatigue (ClinicalTrials.gov: NCT04167475).

Also flagged:Inherited metabolic diseasesenzymetransportercytopeniasmonoclonal gammopathycoagulation
Journal Article 2024-02-14 No Snippets Moutapam-Ngamby-Adriaansen Y, Maillot F, Labarthe F, Lioger B.
Show Full Abstract

Inherited Metabolic Diseases (IMD) encompass a diverse group of rare genetic conditions that, despite their individual rarity, collectively affect a substantial proportion, estimated at as much as 1 in 784 live births. Among their wide-ranging clinical manifestations, cytopenia stands out as a prominent feature. Consequently, IMD should be considered a potential diagnosis when evaluating patients presenting with cytopenia. However, it is essential to note that the existing scientific literature pertaining to the link between IMD and cytopenia is limited, primarily comprising case reports and case series. This paucity of data may contribute to the inadequate recognition of the association between IMD and cytopenia, potentially leading to underdiagnosis. In this review, we synthesize our findings from a literature analysis along with our clinical expertise to offer a comprehensive insight into the clinical presentation of IMD cases associated with cytopenia. Furthermore, we introduce a structured diagnostic approach underpinned by decision-making algorithms, with the aim of enhancing the early identification and management of IMD-related cytopenia.

Also flagged:GdnfRetnephrogenesisFoxd1Gata4Barx1
Journal Article 2024-02-14 No Snippets Qiu C, Martin BK, Welsh IC, Daza RM, Le TM, Huang X, Nichols EK, Taylor ML, Fulton O, O'Day DR, Gomes AR, Ilcisin S, Srivatsan S, Deng X, Disteche CM, Noble WS, Hamazaki N, Moens CB, Kimelman D, Cao J, Schier AF, Spielmann M, Murray SA, Trapnell C, Shendure J.
Show Full Abstract

The house mouse (Mus musculus) is an exceptional model system, combining genetic tractability with close evolutionary affinity to humans<sup>1,2</sup>. Mouse gestation lasts only 3 weeks, during which the genome orchestrates the astonishing transformation of a single-cell zygote into a free-living pup composed of more than 500 million cells. Here, to establish a global framework for exploring mammalian development, we applied optimized single-cell combinatorial indexing<sup>3</sup> to profile the transcriptional states of 12.4 million nuclei from 83 embryos, precisely staged at 2- to 6-hour intervals spanning late gastrulation (embryonic day 8) to birth (postnatal day 0). From these data, we annotate hundreds of cell types and explore the ontogenesis of the posterior embryo during somitogenesis and of kidney, mesenchyme, retina and early neurons. We leverage the temporal resolution and sampling depth of these whole-embryo snapshots, together with published data<sup>4-8</sup> from earlier timepoints, to construct a rooted tree of cell-type relationships that spans the entirety of prenatal development, from zygote to birth. Throughout this tree, we systematically nominate genes encoding transcription factors and other proteins as candidate drivers of the in vivo differentiation of hundreds of cell types. Remarkably, the most marked temporal shifts in cell states are observed within one hour of birth and presumably underlie the massive physiological adaptations that must accompany the successful transition of a mammalian fetus to life outside the womb.

Also flagged:EGFRerlotinibkinaselysinebindingkinases
Journal Article 2024-02-14 No Snippets Zhao Y, Duan K, Fan Y, Li S, Huang L, Tu Z, Sun H, Cook GM, Yang J, Sun P, Tan Y, Ding K, Li Z.
Show Full Abstract

Covalent probes coupled with chemical proteomics represent a powerful method for investigating small molecule and protein interactions. However, the creation of a reactive warhead within various ligands to form covalent probes has been a major obstacle. Herein, we report a convenient and robust process to assemble a unique electrophile, an α-acyloxyenamide, through a one-step late-stage coupling reaction. This procedure demonstrates remarkable tolerance towards other functional groups and facilitates ligand-directed labeling in proteins of interest. The reactive group has been successfully incorporated into a clinical drug targeting the EGFR L858R mutant, erlotinib, and a pan-kinase inhibitor. The resulting probes have been shown to be able to covalently engage a lysine residue proximal to the ATP-binding pocket of the EGFR L858R mutant. A series of active sites, and Mg<sup>2+</sup>, ATP-binding sites of kinases, such as K33 of CDK1, CDK2, CDK5 were detected. This is the first report of engaging these conserved catalytic lysine residues in kinases with covalent inhibition. Further application of this methodology to natural products has demonstrated its success in profiling ligandable conserved lysine residues in whole proteome. These findings offer insights for the development of new targeted covalent inhibitors (TCIs).

CACNA1E
Also flagged:gene expressionRegulation ofresponse toacidificationsignal transductionion transport
Journal Article 2024-02-14 ✓ 4 Snippets Kang J, Chung A, Suresh S, Bonzi LC, Sourisse JM, Ramirez-Calero S, Romeo D, Petit-Marty N, Pegueroles C, Schunter C.
In-Text Gene Mentions

…calcium ion transport (CACNA1E: calcium voltage‐gated channe…

…alpha subunit 2;CACNA1E: calcium voltage‐gated channe…

…anchor protein 6;CACNA1E: calcium voltage‐gated channe…

…neighboring coding geneCACNA1E(voltage‐gated calcium channel…

Show Full Abstract

The majority of the transcribed genome does not have coding potential but these non-coding transcripts play crucial roles in transcriptional and post-transcriptional regulation of protein-coding genes. Regulation of gene expression is important in shaping an organism's response to environmental changes, ultimately impacting their survival and persistence as population or species face global change. However, the roles of long non-coding RNAs (lncRNAs), when confronted with environmental changes, remain largely unclear. To explore the potential role of lncRNAs in fish exposed to ocean acidification (OA), we analyzed publicly available brain RNA-seq data from a coral reef fish <i>Acanthochromis polyacanthus</i>. We annotated the lncRNAs in its genome and examined the expression changes of intergenic lncRNAs (lincRNAs) between <i>A. polyacanthus</i> samples from a natural CO<sub>2</sub> seep and a nearby control site. We identified 4728 lncRNAs, including 3272 lincRNAs in this species. Remarkably, 93.03% of these lincRNAs were species-specific. Among the 125 highly expressed lincRNAs and 403 differentially expressed lincRNAs in response to elevated CO<sub>2</sub>, we observed that lincRNAs were either neighboring or potentially trans-regulating differentially expressed coding genes associated with pH regulation, neural signal transduction, and ion transport, which are known to be important in the response to OA in fish. In summary, lncRNAs may facilitate fish acclimation and mediate the responses of fish to OA by modulating the expression of crucial coding genes, which offers insight into the regulatory mechanisms underlying fish responses to environmental changes.

Also flagged:Colorectal cancercancerpathogenesistumorstumoradenocarcinoma
Journal Article 2024-02-14 No Snippets Pothuraju R, Khan I, Jain M, Bouvet M, Malafa M, Roy HK, Kumar S, Batra SK.
Show Full Abstract

Despite significant advancements in prevention and treatment, colorectal cancer (CRC) remains the third leading cause of cancer-related deaths. Animal models, including xenografts, syngeneic, and genetically engineered, have emerged as indispensable tools in cancer research. These models offer a valuable platform to address critical questions regarding molecular pathogenesis and test therapeutic interventions before moving on to clinical trials. Advancements in CRC animal models have also facilitated the advent of personalized and precision medicine. Patient-derived xenografts and genetically engineered mice that mirror features of human tumors allow for tailoring treatments to specific CRC subtypes, improving treatment outcomes and quality of life. To overcome the limitations of individual model systems, recent studies have employed a multi-modal approach, combining different animal models, 3D organoids, and in vitro studies. This integrative approach provides a comprehensive understanding of CRC biology, including the tumor microenvironment and therapeutic responses, driving the development of more effective and personalized therapeutic interventions. This review discusses the animal models used for CRC research, including recent advancements and limitations of these animal models.

Also flagged:indoleCancertyrosine kinasesVEGFVEGFRcancers
Journal Article 2024-02-14 No Snippets Aboshouk DR, Youssef MA, Bekheit MS, Hamed AR, Girgis AS.
Show Full Abstract

Cancer is one of the most significant health challenges worldwide. Various techniques, tools and therapeutics/materials have been developed in the last few decades for the treatment of cancer, together with great interest, funding and efforts from the scientific society. However, all the reported studies and efforts seem insufficient to combat the various types of cancer, especially the advanced ones. The overexpression of tyrosine kinases is associated with cancer proliferation and/or metastasis. VEGF, an important category of tyrosine kinases, and its receptors (VEGFR) are hyper-activated in different cancers. Accordingly, they are known as important factors in the angiogenesis of different tumors and are considered in the development of effective therapeutic approaches for controlling many types of cancer. In this case, targeted therapeutic approaches are preferable to the traditional non-selective approaches to minimize the side effects and drawbacks associated with treatment. Several indole-containing compounds have been identified as effective agents against VEGFR. Herein, we present a summary of the recent indolyl analogs reported within the last decade (2012-2023) with potential antineoplastic and VEGFR inhibitory properties. The most important drugs, natural products, synthesized potent compounds and promising hits/leads are highlighted. Indoles functionalized and conjugated with various heterocycles beside spiroindoles are also considered.

Also flagged:CHST4Malignant pleural mesotheliomaasbestoscell-cycle-gene expressioncancer
Journal Article 2024-02-14 No Snippets Okado S, Kato T, Hanamatsu Y, Emoto R, Imamura Y, Watanabe H, Kawasumi Y, Kadomatsu Y, Ueno H, Nakamura S, Mizuno T, Takeuchi T, Matsui S, Chen-Yoshikawa TF.
Show Full Abstract

Malignant pleural mesothelioma (MPM) develops primarily from asbestos exposures and has a poor prognosis. In this study, The Cancer Genome Atlas was used to perform a comprehensive survival analysis, which identified the <i>CHST4</i> gene as a potential predictor of favorable overall survival for patients with MPM. An enrichment analysis of favorable prognostic genes, including <i>CHST4</i>, showed immune-related ontological terms, whereas an analysis of unfavorable prognostic genes indicated cell-cycle-related terms. <i>CHST4</i> mRNA expression in MPM was significantly correlated with Bindea immune-gene signatures. To validate the relationship between <i>CHST4</i> expression and prognosis, we performed an immunohistochemical analysis of <i>CHST4</i> protein expression in 23 surgical specimens from surgically treated patients with MPM who achieved macroscopic complete resection. The score calculated from the proportion and intensity staining was used to compare the intensity of <i>CHST4</i> gene expression, which showed that <i>CHST4</i> expression was stronger in patients with a better postoperative prognosis. The median overall postoperative survival was 107.8 months in the high-expression-score group and 38.0 months in the low-score group (<i>p</i> = 0.044, log-rank test). Survival after recurrence was also significantly improved by <i>CHST4</i> expression. These results suggest that <i>CHST4</i> is useful as a prognostic biomarker in MPM.

Also flagged:Colorectal cancercancertotranslationalmethylationmetabolic diseases
Journal Article 2024-02-14 No Snippets Martín-García D, García-Aranda M, Redondo M.
Show Full Abstract

Colorectal cancer (CRC) is a devastating disease that ranks third in diagnosis and as the second leading cause of cancer-related deaths. The early detection of CRC has been shown to be the most effective strategy to improve treatment outcomes and patient survival. Therefore, current lines of research focus on the development of reliable diagnostic tools. Targeted therapies, in combination with standard chemotherapy and immune checkpoint inhibitors, have emerged as promising treatment protocols in CRC. However, their effectiveness is linked to the molecular characteristics of each patient. The importance of discovering biomarkers that help predict response to therapies and assess prognosis is evident as they allow for a fundamental step towards personalized care and successful treatments. Among the ongoing efforts to identify them, mass spectrometry-based translational proteomics presents itself as a unique opportunity as it enables the discovery and application of protein biomarkers that may revolutionize the early detection and treatment of CRC. Our objective is to show the most recent studies focused on the identification of CRC-related protein markers, as well as to provide an updated view of advances in the field of proteomics and cancer.

HTT
Also flagged:HTR2Aserotonindopaminedepressionanxietyaddiction
Journal Article 2024-02-14 ✓ 3 Snippets Dai Y, Zhang C, Zhang L, Wen C, Li H, Zhu T.
In-Text Gene Mentions

HTR2A is a subtype of 5-HTR, which affect 5-HTT function and serotonergic transmission (61, 62), and has thus turned into a research hotspot in substance addiction, aggressive behavior, and obsessive-compulsive disorder in recent years (63–65).

…and serotonin transporter (5-HTT) ( 60 ).…

…5-HTR, which affect5-HTTfunction and serotonergic…

Show Full Abstract

<h4>Introduction</h4>Internet addiction disorder (IAD) has grown into public health concern of global proportions. Previous studies have indicated that individuals with IAD may exhibit altered levels of serotonin and dopamine, which are known to play crucial roles in depression, anxiety, impulsivity, and addiction. Therefore, polymorphisms in the receptors that mediate the effects of serotonin and dopamine and affect their functional states as well as their activities are suspect. In this study, we aimed to investigate the association between IAD and rs6313 (T102C) polymorphism in the serotonin 2A receptor (5-HT2A) gene, (HTR2A).<h4>Methods</h4>Twenty patients with IAD and twenty healthy controls (HCs) were included in this study. Young's Internet Addiction Test (IAT), Self-Rating Anxiety Scale, Self-Rating Depression Scale, Yale-Brown Obsessive-Compulsive Scale (Y-BOCS), Barratt Impulse Scale, Pittsburgh Sleep Quality Index (PSQI), and Social Support Rating Scale (SSRS) were used to assess the severity of internet addiction, mental status, impulsive traits, sleep quality, and social support. Genotyping was performed to identify rs6313 polymorphisms in the HTR2A gene of all participants.<h4>Results</h4>The frequencies of the C and T alleles of HTR2A T102C were 28% and 72% in the IAD group and 53% and 47% in the HCs group, respectively, indicating that the differences between these two groups were significant. No significant difference was observed in the distribution of the CC, CT, and TT genotypes of HTR2A gene T102C between the IAD and the HCs groups. Additionally, there was no difference in the distribution of the frequencies of the HTR2A gene T102C CC and CT+TT genotypes between the two groups. However, the distribution between the TT and CC+CT genotypes showed an apparent statistical difference in the HTR2A gene T102C between the two groups. Correlation analysis indicated that the IAT score was positively correlated with the Y-BOCS and BIS scores for the CC+CT genotype in patients with IAD. Moreover, the IAT score was positively correlated with the PSQI score in patients with IAD carrying the TT genotype.<h4>Conclusion</h4>The present study demonstrates that rs6313 in HTR2A is associated with IAD, and that the T allele of rs6313 in HTR2A may be a risk factor for IAD.

Also flagged:acute respiratory infectionsrespiratory infectionsCOVID-19Infectionsinfectious diseasesinfection
Journal Article 2024-02-14 No Snippets Andrup L, Krogfelt KA, Stephansen L, Hansen KS, Graversen BK, Wolkoff P, Madsen AM.
Show Full Abstract

<h4>Objective</h4>Children who start in day-care have 2-4 times as many respiratory infections compared to children who are cared for at home, and day-care staff are among the employees with the highest absenteeism. The extensive new knowledge that has been generated in the COVID-19 era should be used in the prevention measures we prioritize. The purpose of this narrative review is to answer the questions: Which respiratory viruses are the most significant in day-care centers and similar indoor environments? What do we know about the transmission route of these viruses? What evidence is there for the effectiveness of different non-pharmaceutical prevention measures?<h4>Design</h4>Literature searches with different terms related to respiratory infections in humans, mitigation strategies, viral transmission mechanisms, and with special focus on day-care, kindergarten or child nurseries, were conducted in PubMed database and Web of Science. Searches with each of the main viruses in combination with transmission, infectivity, and infectious spread were conducted separately supplemented through the references of articles that were retrieved.<h4>Results</h4>Five viruses were found to be responsible for ≈95% of respiratory infections: rhinovirus, (RV), influenza virus (IV), respiratory syncytial virus (RSV), coronavirus (CoV), and adenovirus (AdV). Novel research, emerged during the COVID-19 pandemic, suggests that most respiratory viruses are primarily transmitted in an airborne manner carried by aerosols (microdroplets).<h4>Conclusion</h4>Since airborne transmission is dominant for the most common respiratory viruses, the most important preventive measures consist of better indoor air quality that reduces viral concentrations and viability by appropriate ventilation strategies. Furthermore, control of the relative humidity and temperature, which ensures optimal respiratory functionality and, together with low resident density (or mask use) and increased time outdoors, can reduce the occurrence of respiratory infections.

HFE
Also flagged:metabolismCYP2C19Clopidogrelsertralinefluoxetinecitalopram
Journal Article 2024-02-14 ✓ 1 Snippet Shubbar Q, Alchakee A, Issa KW, Adi AJ, Shorbagi AI, Saber-Ayad M.
In-Text Gene Mentions

The Liver Disease and Drug Metabolism Panel which includes CYP2C19, UGT1A1, HFE, and other genes, covers genetic variables impacting liver disorders and drug metabolism, which are relevant in gastrointestinal (Liu et al., 2022) and could be very relevant to clinical practice due to the liver’s crucial function in digestion and drug processing.

Show Full Abstract

The <i>CYP2C19</i> gene is frequently included in different pharmacogenomic panels tested in clinical practice, due to its involvement in the metabolism of a myriad of frequently prescribed medications. Accordingly, <i>CYP2C19</i> genotyping can promote precise therapeutic decisions and avoid the occurrence of significant drug-drug-gene interactions in the clinical setting. A comprehensive examination of the role of the <i>CYP2C19</i> gene in real-world medical settings is presented in this review. This review summarizes the most recent information on how genetic variants in <i>CYP2C19</i> affect drug metabolism and therapeutic outcomes. It goes into the wide range of CYP2C19 phenotypes, with different degrees of metabolizing activity, and their implications for customized medication response through a review of the literature. The review also analyzes the clinical significance of <i>CYP2C19</i> in several medical specialties, including cardiology, psychiatry, and gastro-enterology clinics, and illuminates how it affects pharmacological efficacy, safety, and adverse effects. Finally, <i>CYP2C19</i>-supported clinical decision-making is outlined, highlighting the possibility of improving therapeutic outcomes and achieving more affordable treatment options, a step towards optimizing healthcare provision through precision medicine.

Also flagged:assemblytumorcell senescencecancervalsartandoxorubicin
Journal Article 2024-02-14 No Snippets Liang C, Zhang G, Guo L, Ding X, Yang H, Zhang H, Zhang Z, Hou L.
Show Full Abstract

Induction of tumor cell senescence has become a promising strategy for anti-tumor immunotherapy, but fibrotic matrix severely blocks senescence inducers penetration and immune cells infiltration. Herein, we designed a cancer-associated fibroblasts (CAFs) triggered structure-transformable nano-assembly (HSD-P@V), which can directionally deliver valsartan (Val, CAFs regulator) and doxorubicin (DOX, senescence inducer) to the specific targets. In detail, DOX is conjugated with hyaluronic acid (HA) via diselenide bonds (Se-Se) to form HSD micelles, while CAFs-sensitive peptide is grafted onto the HSD to form a hydrophilic polymer, which is coated on Val nanocrystals (VNs) surface for improving the stability and achieving responsive release. Once arriving at tumor microenvironment and touching CAFs, HSD-P@V disintegrates into VNs and HSD micelles due to sensitive peptide detachment. VNs can degrade the extracellular matrix, leading to the enhanced penetration of HSD. HSD targets tumor cells, releases DOX to induce senescence, and recruits effector immune cells. Furthermore, senescent cells are cleared by the recruited immune cells to finish the integrated anti-tumor therapy. <i>In vitro</i> and <i>in vivo</i> results show that the nano-assembly remarkably inhibits tumor growth as well as lung metastasis, and extends tumor-bearing mice survival. This work provides a promising paradigm of programmed delivering multi-site nanomedicine for cancer immunotherapy.

HFE
Also flagged:gadoliniummyocardial diseasescardiovascular diseasespositronsegmentationinfarction
Journal Article 2024-02-14 ✓ 1 Snippet Choe YH, Kim SM.
In-Text Gene Mentions

hemochromatosis

Show Full Abstract

Recent technical innovation enables faster and more reliable cardiac magnetic resonance (CMR) imaging than before. Artificial intelligence is used in improving image resolution, fast scanning, and automated analysis of CMR. Fast CMR techniques such as compressed sensing technique enable fast cine, perfusion, and late gadolinium-enhanced imaging and improve patient throughput and widening CMR indications. CMR feature-tracking technique gives insight on diastolic function parameters of ventricles and atria with prognostic implications. Myocardial parametric mapping became to be included in the routine CMR protocol. CMR fingerprinting enables simultaneous quantification of myocardial T1 and T2. These parameters may give information on myocardial alteration in the preclinical stages in various myocardial diseases. Four-dimensional flow imaging shows hemodynamic characteristics in or through the cardiovascular structures visually and gives quantitative values of vortex, kinetic energy, and wall-shear stress. In conclusion, CMR is an essential modality in the diagnosis of various cardiovascular diseases, especially myocardial diseases. Recent progress in CMR techniques promotes more widespread use of CMR in clinical practice. This review summarizes recent updates in CMR technologies and clinical research.

bioRxiv 2024-02-14 Preprint (No Snippets API) Nanajkar N, Sahoo A, Matysiak S.
Show Full Abstract

Huntington’s disease (HD) is a fatal neurodegenerative disorder resulting from an abnormal expansion of polyglutamine (polyQ) repeats in the N terminus of the Huntingtin protein. When the polyQ tract surpasses 35 repeats, the mutated protein undergoes misfolding, culminating in the formation of intracellular aggregates. Research in mouse models suggests that HD pathogenesis involves the aggregation of N-terminal fragments of the Huntingtin protein (htt). These early oligomeric assemblies of htt, exhibiting diverse characteristics during aggregation, are implicated as potential toxic entities in HD. However, a consensus on their specific structures remains elusive. Understanding the heterogeneous nature of htt oligomers provides crucial insights into disease mechanisms, emphasizing the need to identify various oligomeric conformations as potential therapeutic targets. Employing coarse-grained molecular dynamics, our study aims to elucidate the mechanisms governing the aggregation process and resultant aggregate architectures of htt. The polyQ tract within htt is flanked by two regions: an N-terminal domain (N17) and a short C-terminal proline-rich segment. We conducted self-assembly simulations involving five distinct N17 + polyQ systems with polyQ lengths ranging from 7 to 45, utilizing the ProMPT force field. Prolongation of the polyQ domain correlates with an increase in β -sheet-rich structures. Longer polyQ lengths favor intra-molecular β -sheets over inter-molecular interactions due to the folding of the elongated polyQ domain into hairpin-rich conformations. Importantly, variations in polyQ length significantly influence resulting oligomeric structures. Shorter polyQ domains lead to N17 domain aggregation, forming a hydrophobic core, while longer polyQ lengths introduce a competition between N17 hydrophobic interactions and polyQ polar interactions, resulting in densely packed polyQ cores with outwardly distributed N17 domains. Additionally, at extended polyQ lengths, we observe distinct oligomeric conformations with varying degrees of N17 bundling. These findings can help explain the toxic gain-of function that htt with expanded polyQ acquires. <h4>Author summary</h4> Our study delves into Huntington’s disease (HD), a devastating neurodegenerative disorder triggered by abnormal expansions of polyglutamine repeats in the Huntingtin protein. When these repeats exceed a critical threshold, the protein misfolds, leading to the formation of harmful intracellular aggregates. Using computational techniques, we explored the intricate process by which these aggregates form and examined their complex structures. Our findings shed light on the diverse nature of the protein fragments involved in HD pathology, emphasizing the importance of identifying various structural forms as potential targets for therapeutic intervention. We observed that changes in the length of the polyglutamine tract significantly impact the resulting aggregate structures, revealing insights into the disease mechanism. Specifically, we found that an expansion of the polyglutamine domain leads to distinct aggregate morphologies. In addition, the way the first 17 amino acids of these protein fragments pack against each other in the aggregates depends on the length of the polyglutamine repeats. By uncovering these structural intricacies, our study contributes to a deeper understanding of HD and may pave the way for the development of targeted treatments aimed at disrupting or preventing the formation of toxic protein aggregates.

GPR52
Also flagged:GLP-1RGCGRGIPRClass B1G protein-coupled receptorsGPCRs
Journal Article 2024-02-13 ✓ 1 Snippet Cong Z, Zhao F, Li Y, Luo G, Mai Y, Chen X, Chen Y, Lin S, Cai X, Zhou Q, Yang D, Wang MW.
In-Text Gene Mentions

…GPR21 22 ,GPR5223 , GPR17…

Show Full Abstract

Class B1 G protein-coupled receptors (GPCRs) are important regulators of many physiological functions such as glucose homeostasis, which is mainly mediated by three peptide hormones, i.e., glucagon-like peptide-1 (GLP-1), glucagon (GCG), and glucose-dependent insulinotropic polypeptide (GIP). They trigger a cascade of signaling events leading to the formation of an active agonist-receptor-G protein complex. However, intracellular signal transducers can also activate the receptor independent of extracellular stimuli, suggesting an intrinsic role of G proteins in this process. Here, we report cryo-electron microscopy structures of the human GLP-1 receptor (GLP-1R), GCG receptor (GCGR), and GIP receptor (GIPR) in complex with G<sub>s</sub> proteins without the presence of cognate ligands. These ligand-free complexes share a similar intracellular architecture to those bound by endogenous peptides, in which, the G<sub>s</sub> protein alone directly opens the intracellular binding cavity and rewires the extracellular orthosteric pocket to stabilize the receptor in a state unseen before. While the peptide-binding site is partially occupied by the inward folded transmembrane helix 6 (TM6)-extracellular loop 3 (ECL3) juncture of GIPR or a segment of GCGR ECL2, the extracellular portion of GLP-1R adopts a conformation close to the active state. Our findings offer valuable insights into the distinct activation mechanisms of these three important receptors. It is possible that in the absence of a ligand, the intracellular half of transmembrane domain is mobilized with the help of G<sub>s</sub> protein, which in turn rearranges the extracellular half to form a transitional conformation, facilitating the entry of the peptide N-terminus.

Also flagged:subarachnoid hemorrhageintracranial aneurysmscerebrovascular diseasedeathFerroptosisiron
Journal Article 2024-02-13 No Snippets Kang J, Tian S, Zhang L, Yang G.
Show Full Abstract

Spontaneous subarachnoid hemorrhage (SAH), mainly caused by ruptured intracranial aneurysms, is a serious acute cerebrovascular disease. Early brain injury (EBI) is all brain injury occurring within 72 h after SAH, mainly including increased intracranial pressure, decreased cerebral blood flow, disruption of the blood-brain barrier, brain edema, oxidative stress, and neuroinflammation. It activates cell death pathways, leading to neuronal and glial cell death, and is significantly associated with poor prognosis. Ferroptosis is characterized by iron-dependent accumulation of lipid peroxides and is involved in the process of neuron and glial cell death in early brain injury. This paper reviews the research progress of ferroptosis in early brain injury after subarachnoid hemorrhage and provides new ideas for future research.

OLFM4
Also flagged:doxorubicinmechanistic target of rapamycin complex 1mTORC1rapamycinDdit4DNA-damage-inducible transcript 4
Journal Article 2024-02-13 ✓ 1 Snippet Deans-Fielder K, Wu T, Nguyen T, To S, Huang YZ, Bark SJ, Mills JC, Shroyer NF.
In-Text Gene Mentions

Olfm4

Show Full Abstract

Genotoxic agents such as doxorubicin (DXR) can cause damage to the intestines that can be ameliorated by fasting. How fasting is protective and the optimal timing of fasting and refeeding remain unclear. Here, our analysis of fasting/refeeding-induced global intestinal transcriptional changes revealed metabolic shifts and implicated the cellular energetic hub mechanistic target of rapamycin complex 1 (mTORC1) in protecting from DXR-induced DNA damage. Our analysis of specific transcripts and proteins in intestinal tissue and tissue extracts showed that fasting followed by refeeding at the time of DXR administration reduced damage and caused a spike in mTORC1 activity. However, continued fasting after DXR prevented the mTORC1 spike and damage reduction. Surprisingly, the mTORC1 inhibitor, rapamycin, did not block fasting/refeeding-induced reduction in DNA damage, suggesting that increased mTORC1 is dispensable for protection against the initial DNA damage response. In <i>Ddit4<sup>-/-</sup></i> mice [DDIT4 (DNA-damage-inducible transcript 4) functions to regulate mTORC1 activity], fasting reduced DNA damage and increased intestinal crypt viability vs. ad libitum-fed <i>Ddit4<sup>-/-</sup></i> mice. Fasted/refed <i>Ddit4<sup>-/-</sup></i> mice maintained body weight, with increased crypt proliferation by 5 days post-DXR, whereas ad libitum-fed <i>Ddit4<sup>-/-</sup></i> mice continued to lose weight and displayed limited crypt proliferation. Genes encoding epithelial stem cell and DNA repair proteins were elevated in DXR-injured, fasted vs. ad libitum <i>Ddit4<sup>-/-</sup></i> intestines. Thus, fasting strongly reduced intestinal damage when normal dynamic regulation of mTORC1 was lost. Overall, the results confirm that fasting protects the intestines against DXR and suggests that fasting works by pleiotropic - including both mTORC1-dependent and independent - mechanisms across the temporally dynamic injury response.<b>NEW & NOTEWORTHY</b> New findings are <i>1</i>) DNA damage reduction following a 24-h fast depends on the timing of postfast refeeding in relation to chemotherapy initiation; <i>2</i>) fasting/refeeding-induced upregulation of mTORC1 activity is not required for early (6 h) protection against DXR-induced DNA damage; and <i>3</i>) fasting increases expression of intestinal stem cell and DNA damage repair genes, even when mTORC1 is dysregulated, highlighting fasting's crucial role in regulating mTORC1-dependent and independent mechanisms in the dynamic recovery process.

PRDX6
Also flagged:surfactant protein Anonapeptideperoxiredoxin 6amino acidacute lung injuryNADPH oxidases
Journal Article 2024-02-13 ✓ 2 Snippets Fisher AB, Zani B, Han T, Dodia C, Melidone R, Keller S.
In-Text Gene Mentions

…of peroxiredoxin 6 (Prdx6), thereby preventing rac…

Prdx6

Show Full Abstract

This study addressed the efficacy of a liposome-encapsulated nine amino acid peptide [peroxiredoxin 6 PLA<sub>2</sub> inhibitory peptide-2 (PIP-2)] for the prevention or treatment of acute lung injury (ALI) +/- sepsis. PIP-2 inhibits the PLA<sub>2</sub> activity of peroxiredoxin 6 (Prdx6), thereby preventing rac release and activation of NADPH oxidases (NOXes), types 1 and 2. Female Yorkshire pigs were infused intravenously with lipopolysaccharide (LPS) + liposomes (untreated) or LPS + PIP-2 encapsulated in liposomes (treated). Pigs were mechanically ventilated and continuously monitored; they were euthanized after 8 h or earlier if preestablished humane endpoints were reached. Control pigs (mechanical ventilation, no LPS) were essentially unchanged over the 8 h study. LPS administration resulted in systemic inflammation with manifestations of clinical sepsis-like syndrome, decreased lung compliance, and a marked decrease in the arterial Po<sub>2</sub> with vascular instability leading to early euthanasia of 50% of untreated animals. PIP-2 treatment significantly reduced the requirement for supportive vasopressors and the manifestations of lung injury so that only 25% of animals required early euthanasia. Bronchoalveolar lavage fluid from PIP-2-treated versus untreated pigs showed markedly lower levels of total protein, cytokines (TNF-α, IL-6, IL-1β), and myeloperoxidase. Thus, the porcine LPS-induced sepsis-like model was associated with moderate to severe lung pathophysiology compatible with ALI, whereas treatment with PIP-2 markedly decreased lung injury, cardiovascular instability, and early euthanasia. These results indicate that inhibition of reactive oxygen species (ROS) production via NOX1/2 has a beneficial effect in treating pigs with LPS-induced ALI plus or minus a sepsis-like syndrome, suggesting a potential role for PIP-2 in the treatment of ALI and/or sepsis in humans.<b>NEW & NOTEWORTHY</b> Currently available treatments that can alter lung inflammation have failed to significantly alter mortality of acute lung injury (ALI). Peroxiredoxin 6 PLA<sub>2</sub> inhibitory peptide-2 (PIP-2) targets the liberation of reactive O<sub>2</sub> species (ROS) that is associated with adverse cell signaling events, thereby decreasing the tissue oxidative injury that occurs early in the ALI syndrome. We propose that treatment with PIP-2 may be effective in preventing progression of early disease into its later stages with irreversible lung damage and relatively high mortality.

SERPINC1
Also flagged:PD1cancernon-small cell lung cancerNSCLCalveolar soft part sarcomaASPS
Journal Article 2024-02-13 ✓ 5 Snippets Tan Q, Gao R, Zhang X, Yang J, Xing P, Yang S, Wang D, Wang G, Wang S, Yao J, Zhang Z, Tang L, Yu X, Han X, Shi Y.
In-Text Gene Mentions

In addition, the SERPINC1 gene encodes the antithrombin III protein, which was identified in our cohort to be correlated with tumor size and can serve as a monitoring biomarker; medicines targeting SERPINC1 have been approved for venous thrombosis and coagulation defect treatment, although the combinatorial effect of SERPINC1-targeted therapy with anti-PD1 antibodies has yet to be explored.

To address this question, we validated eight plasma proteins (IL-17A, F5, FLT4, SFTPB, and GNPTG in lymphoma, TNFSF12, CCL3, and KIT in NSCLC) for response prediction and three plasma proteins (IL36G, SERPINC1, and LTA) for relapse monitoring.

…plasma proteins (IL36G,SERPINC1, and LTA) for…

…In addition, theSERPINC1gene encodes the…

…biomarker; medicines targetingSERPINC1have been approved…

Show Full Abstract

The response rate of anti-PD1 therapy is limited, and the influence of anti-PD1 therapy on cancer patients is unclear. To address these challenges, we conducted a longitudinal analysis of plasma proteomic changes with anti-PD1 therapy in non-small cell lung cancer (NSCLC), alveolar soft part sarcoma (ASPS), and lymphoma patients. We included 339 plasma samples before and after anti-PD1 therapy from 193 patients with NSCLC, ASPS, or lymphoma. The plasma proteins were detected using data-independent acquisition-mass spectrometry and customable antibody microarrays. Differential proteomic characteristics in responders (R) and non-responders (NR) before and after anti-PD1 therapy were elucidated. A total of 1019 proteins were detected using our in-depth proteomics platform and distributed across 10-12 orders of abundance. By comparing the differential plasma proteome expression between R and NR groups, 50, 206, and 268 proteins were identified in NSCLC, ASPS, and lymphoma patients, respectively. Th17, IL-17, and JAK-STAT signal pathways were identified upregulated in NR group, while cellular senescence and transcriptional misregulation pathways were activated in R group. Longitudinal proteomics analysis revealed the IL-17 signaling pathway was downregulated after treatment. Consistently, many proteins were identified as potential combinatorial therapeutic targets (e.g., IL-17A and CD22). Five noninvasive biomarkers (FLT4, SFTPB, GNPTG, F5, and IL-17A) were further validated in an independent lymphoma cohort (n = 39), and another three noninvasive biomarkers (KIT, CCL3, and TNFSF1) were validated in NSCLC cohort (n = 76). Our results provide molecular insights into the anti-PD1 therapy in cancer patients and identify new therapeutic strategies for anti-PD1-resistant patients.

Also flagged:alkalimetalsanionsphosphorPhosphatesions
Journal Article 2024-02-13 No Snippets Reddy L.
Show Full Abstract

This work is inspired from the comprehensive work done by our research team aimed at improving the efficiency of white light emitting diodes (LEDs) through improvements in the colour rendering index of the red light (CRI), one of the primary colours of white light. Such work is triggered through the incorporation of anions (BO<sub>3</sub><sup>3-</sup>, PO<sub>4</sub><sup>3-</sup>, SO<sub>4</sub><sup>2-</sup>), either individually or as an integral part of dopant activated inorganic phosphor host materials. Numerous host materials such as ZnO, Y<sub>2</sub>O<sub>3</sub>, Ca<sub>3</sub>(PO<sub>4</sub>)<sub>2</sub>, CaMoO<sub>4</sub>, ABPO<sub>4</sub>, ABSO<sub>4</sub> (where A represents alkali metals and B alkaline earth metals) have been considered ideal hosts materials for studying luminescence properties of materials (including other phosphors). In addition, red emitting dopants such as Sm<sup>3+</sup>, Eu<sup>3+</sup> and Ce<sup>3+</sup> have been incorporated into these host materials to achieve a higher CRI of red colour, an essential component of white light. The role anions in various materials is multifaceted; firstly, it acts as sensitizer whereby it absorbs excitation energy and transfers it non-radiatively to the dopants, secondly, it acts as a charge compensator to dopants with a charge of + 3, thirdly, it creates crystal fields that affects the electronic transitions of the dopants and fourthly, it creates a stable crystal structure that allows for dopant embedding. By understanding the exact role of these anions and their interactions with the host lattice and dopant ions, we could further optimize the luminescent properties of these activated host materials, which leads to higher efficiencies and performances in white light-emitting diodes and other lighting technologies. This work is a comprehensive review of the work undertaken by our research team aimed at enhancing the luminescent properties of WLEDs.

PRDX6
Also flagged:Liver cancercancerobesitymetabolic diseasestype 2 diabetesinsulin resistance
Journal Article 2024-02-13 ✓ 1 Snippet Wang X, Wang X, Zhang L, Dong B.
In-Text Gene Mentions

PRDX6

Show Full Abstract

Liver cancer is the third leading cause of cancer-related deaths and ranks as the sixth most prevalent cancer type globally. NAFLD or metabolic dysfunction-associated steatotic liver disease, and its more severe manifestation, NASH or metabolic dysfunction-associated steatohepatitis (MASH), pose a significant global health concern, affecting approximately 20%-25% of the population. The increased prevalence of metabolic dysfunction-associated steatotic liver disease and MASH is parallel to the increasing rates of obesity-associated metabolic diseases, including type 2 diabetes, insulin resistance, and fatty liver diseases. MASH can progress to MASH-related HCC (MASH-HCC) in about 2% of cases each year, influenced by various factors such as genetic mutations, carcinogen exposure, immune microenvironment, and microbiome. MASH-HCC exhibits distinct molecular and immune characteristics compared to other causes of HCC and affects both men and women equally. The management of early to intermediate-stage MASH-HCC typically involves surgery and locoregional therapies, while advanced HCC is treated with systemic therapies, including anti-angiogenic therapies and immune checkpoint inhibitors. In this comprehensive review, we consolidate previous research findings while also providing the most current insights into the intricate molecular processes underlying MASH-HCC development. We delve into MASH-HCC-associated genetic variations and somatic mutations, disease progression and research models, multiomics analysis, immunological and microenvironmental impacts, and discuss targeted/combined therapies to overcome immune evasion and the biomarkers to recognize treatment responders. By furthering our comprehension of the molecular mechanisms underlying MASH-HCC, our goal is to catalyze the advancement of more potent treatment strategies, ultimately leading to enhanced patient outcomes.

OLFM4
Also flagged:leucine-rich, repeat-containing GPCR 5Lgr5graft-versus-host diseaseGVHDAcute GVHDcorticosteroids
Journal Article 2024-02-13 ✓ 5 Snippets Arnhold V, Chang WY, Jansen SA, Thangavelu G, Calafiore M, Vinci P, Fu YY, Ito T, Takashima S, Egorova A, Kuttiyara J, Perlstein A, van Hoesel M, Liu C, Blazar BR, Lindemans CA, Hanash AM.
In-Text Gene Mentions

Furthermore, assessment of Olfm4+ ISCs in this model indicated that, while MP treatment on its own decreased stem cell frequencies, the addition of F-652 increased them (Figure 6Q).

…) B6, andOlfm4-GFP-IRES-CreERT2 ( Olfm4-CreE…

…and Olfm4-GFP-IRES-CreERT2 (Olfm4-CreERT2 ) B6 mice…

…Nr3c1 fl/flOlfm4-CreERT2 mice were created…

…Laboratory [JAX]) withOlfm4-CreERT2 mice.…

Show Full Abstract

Corticosteroid treatment (CST) failure is associated with poor outcomes for patients with gastrointestinal (GI) graft-versus-host disease (GVHD). CST is intended to target the immune system, but the glucocorticoid receptor (GR) is widely expressed, including within the intestines, where its effects are poorly understood. Here, we report that corticosteroids (CS) directly targeted intestinal epithelium, potentially worsening immune-mediated GI damage. CS administered to mice in vivo and intestinal organoid cultures ex vivo reduced epithelial proliferation. Following irradiation, immediate CST mitigated GI damage but delayed treatment attenuated regeneration and exacerbated damage. In a murine steroid-refractory (SR) GVHD model, CST impaired epithelial regeneration, worsened crypt loss, and reduced intestinal stem cell (ISC) frequencies. CST also exacerbated immune-mediated damage in organoid cultures with SR, GR-deficient T cells or IFN-γ. These findings correlated with CS-dependent changes in apoptosis-related gene expression and STAT3-related epithelial proliferation. Conversely, IL-22 administration enhanced STAT3 activity and overcame CS-mediated attenuation of regeneration, reducing crypt loss and promoting ISC expansion in steroid-treated mice with GVHD. Therefore, CST has the potential to exacerbate GI damage if it fails to control the damage-inducing immune response, but this risk may be countered by strategies augmenting epithelial regeneration, thus providing a rationale for clinical approaches combining such tissue-targeted therapies with immunosuppression.

Also flagged:Asthmapost-traumatic stress disorderPTSDacute asthma(IL)-1αIL-2
Journal Article 2024-02-13 No Snippets Wisnivesky JP, Agrawal N, Ankam J, Gonzalez A, Federman A, Markowitz SB, Birmingham JM, Busse PJ.
Show Full Abstract

<h4>Background</h4>Post-traumatic stress disorders (PTSD) is associated with worse asthma outcomes in individuals exposed to the World Trade Center (WTC) site.<h4>Research question</h4>Do WTC workers with coexisting PTSD and asthma have a specific inflammatory pattern that underlies the relationship with increased asthma morbidity?<h4>Study design and methods</h4>We collected data on a cohort of WTC workers with asthma recruited from the WTC Health Program. Diagnosis of PTSD was ascertained with a Structured Clinical Interview for DSM-5 (Diagnostic and Statistical Manuel of Mental Disorders) and the severity of PTSD symptoms was assessed with the PTSD Checklist 5. We obtained blood and sputum samples to measure cytokines levels in study participants.<h4>Results</h4>Of the 232 WTC workers with diagnosis of asthma in the study, 75 (32%) had PTSD. PTSD was significantly associated with worse asthma control (p = 0.002) and increased resource utilization (p = 0.0002). There was no significant association (p>0.05) between most blood or sputum cytokines with PTSD diagnosis or PCL-5 scores both in unadjusted and adjusted analyses.<h4>Interpretation</h4>Our results suggest that PTSD is not associated with blood and sputum inflammatory markers in WTC workers with asthma. These findings suggest that other mechanisms likely explain the association between PTSD and asthma control in WTC exposed individuals.

Also flagged:topoisomerase IItriazoloacridinoneInvasive fungal infectionsCOVID-19catalytic activityLysine
Journal Article 2024-02-13 No Snippets Rząd K, Gabriel I, Paluszkiewicz E, Kuplińska A, Olszewski M, Chylewska A, Dąbrowska AM, Kozłowska-Tylingo K.
Show Full Abstract

Fungal pathogens are considered as serious factors for deadly diseases and are a case of medical concern. Invasive fungal infections also complicate the clinical course of COVID-19, leading to a significant increase in mortality. Furthermore, fungal strains' multidrug resistance has increased the demand for antifungals with a different mechanism of action. The present study aimed to identify antifungal compounds targeting yeast topoisomerase II (yTOPOII) derived from well-known human topoisomerase II (hTOPOII) poisons C-1305 and C-1311. Two sets of derivatives: triazoloacridinones (IKE1-8) and imidazoacridinones (IKE9-14) were synthetized and evaluated with a specific emphasis on the molecular mechanism of action. Our results indicated that their effectiveness as enzyme inhibitors was not solely due to intercalation ability but also as a result of influence on catalytic activity by the formation of covalent complexes between plasmid DNA and yTOPOII. Lysine conjunction increased the strength of the compound's interaction with DNA and improved penetration into the fungal cells. Triazoloacridinone derivatives in contrast to starting compound C-1305 exhibited moderate antifungal activity and at least twice lower cytotoxicity. Importantly, compounds (IKE5-8) were not substrates for multidrug ABC transporters whereas a derivative conjugated with lysine (IKE7), showed the ability to overcome C. glabrata fluconazole-resistance (MIC 32-64 µg mL<sup>-1</sup>).

SUDS3OLFM4
Also flagged:colorectal cancertumorstumorPDS3LGR5ANXA1
Journal Article 2024-02-13 ✓ 2 Snippets Malla SB, Byrne RM, Lafarge MW, Corry SM, Fisher NC, Tsantoulis PK, Mills ML, Ridgway RA, Lannagan TRM, Najumudeen AK, Gilroy KL, Amirkhah R, Maguire SL, Mulholland EJ, Belnoue-Davis HL, Grassi E, Viviani M, Rogan E, Redmond KL, Sakhnevych S, McCooey AJ, Bull C, Hoey E, Sinevici N, Hall H, Ahmaderaghi B, Domingo E, Blake A, Richman SD, Isella C, Miller C, Bertotti A, Trusolino L, Loughrey MB, Kerr EM, Tejpar S, S:CORT consortium, Maughan TS, Lawler M, Campbell AD, Leedham SJ, Koelzer VH, Sansom OJ, Dunne PD.
In-Text Gene Mentions

…Clu (427898) andOlfm4(311838).…

…association with thepolycomb repressiverepressive complex (PRC),…

Show Full Abstract

Molecular stratification using gene-level transcriptional data has identified subtypes with distinctive genotypic and phenotypic traits, as exemplified by the consensus molecular subtypes (CMS) in colorectal cancer (CRC). Here, rather than gene-level data, we make use of gene ontology and biological activation state information for initial molecular class discovery. In doing so, we defined three pathway-derived subtypes (PDS) in CRC: PDS1 tumors, which are canonical/LGR5<sup>+</sup> stem-rich, highly proliferative and display good prognosis; PDS2 tumors, which are regenerative/ANXA1<sup>+</sup> stem-rich, with elevated stromal and immune tumor microenvironmental lineages; and PDS3 tumors, which represent a previously overlooked slow-cycling subset of tumors within CMS2 with reduced stem populations and increased differentiated lineages, particularly enterocytes and enteroendocrine cells, yet display the worst prognosis in locally advanced disease. These PDS3 phenotypic traits are evident across numerous bulk and single-cell datasets, and demark a series of subtle biological states that are currently under-represented in pre-clinical models and are not identified using existing subtyping classifiers.

BTN3A3
Also flagged:Interferon-β-associated neurocognitive disordersHANDtype 1 interferonsIFNs)envelope glycoprotein
Journal Article 2024-02-13 ✓ 2 Snippets Singh H, Koury J, Maung R, Roberts AJ, Kaul M.
In-Text Gene Mentions

BTN3A3

butyrophilin subfamily 3 member A3

Show Full Abstract

Human immunodeficiency virus-1 (HIV-1) infects the central nervous system (CNS) and causes HIV-associated neurocognitive disorders (HAND) in about half of the population living with the virus despite combination anti-retroviral therapy (cART). HIV-1 activates the innate immune system, including the production of type 1 interferons (IFNs) α and β. Transgenic mice expressing HIV-1 envelope glycoprotein gp120 (HIVgp120tg) in the CNS develop memory impairment and share key neuropathological features and differential CNS gene expression with HIV patients, including the induction of IFN-stimulated genes (ISG). Here we show that knocking out IFNβ (IFNβKO) in HIVgp120tg and non-tg control mice impairs recognition and spatial memory, but does not affect anxiety-like behavior, locomotion, or vision. The neuropathology of HIVgp120tg mice is only moderately affected by the KO of IFNβ but in a sex-dependent fashion. Notably, in cerebral cortex of IFNβKO animals presynaptic terminals are reduced in males while neuronal dendrites are reduced in females. The IFNβKO results in the hippocampal CA1 region of both male and female HIVgp120tg mice in an ameliorated loss of neuronal presynaptic terminals but no protection of neuronal dendrites. Only female IFNβ-deficient HIVgp120tg mice display diminished microglial activation in cortex and hippocampus and increased astrocytosis in hippocampus compared to their IFNβ-expressing counterparts. RNA expression for some immune genes and ISGs is also affected in a sex-dependent way. The IFNβKO abrogates or diminishes the induction of MX1, DDX58, IRF7 and IRF9 in HIVgp120tg brains of both sexes. Expression analysis of neurotransmission related genes reveals an influence of IFNβ on multiple components with more pronounced changes in IFNβKO females. In contrast, the effects of IFNβKO on MAPK activities are independent of sex with pronounced reduction of active ERK1/2 but also of active p38 in the HIVgp120tg brain. In summary, our findings show that the absence of IFNβ impairs memory dependent behavior and modulates neuropathology in HIVgp120tg brains, indicating that its absence may facilitate development of HAND. Moreover, our data suggests that endogenous IFNβ plays a vital role in maintaining neuronal homeostasis and memory function.

HFE
Also flagged:Hepatocellular Carcinomaliver tumorsLiver CanceralbuminPrimary liver tumorscancer
Journal Article 2024-02-13 ✓ 1 Snippet Martínez-Blanco P, Suárez M, Gil-Rojas S, Torres AM, Martínez-García N, Blasco P, Torralba M, Mateo J.
In-Text Gene Mentions

…HCV, HBV, MASLD,hemochromatosis, autoimmune hepatitis, etc.).…

Show Full Abstract

<h4>Background</h4>Hepatocellular carcinoma (HCC) accounts for 75% of primary liver tumors. Controlling risk factors associated with its development and implementing screenings in risk populations does not seem sufficient to improve the prognosis of these patients at diagnosis. The development of a predictive prognostic model for mortality at the diagnosis of HCC is proposed.<h4>Methods</h4>In this retrospective multicenter study, the analysis of data from 191 HCC patients was conducted using machine learning (ML) techniques to analyze the prognostic factors of mortality that are significant at the time of diagnosis. Clinical and analytical data of interest in patients with HCC were gathered.<h4>Results</h4>Meeting Milan criteria, Barcelona Clinic Liver Cancer (BCLC) classification and albumin levels were the variables with the greatest impact on the prognosis of HCC patients. The ML algorithm that achieved the best results was random forest (RF).<h4>Conclusions</h4>The development of a predictive prognostic model at the diagnosis is a valuable tool for patients with HCC and for application in clinical practice. RF is useful and reliable in the analysis of prognostic factors in the diagnosis of HCC. The search for new prognostic factors is still necessary in patients with HCC.

NEGR1
Also flagged:Spinal Cord Injuriesspinal cord injurymyelinwateraxondextranamine
Journal Article 2024-02-13 ✓ 1 Snippet Calderone A, Cardile D, De Luca R, Quartarone A, Corallo F, Calabrò RS.
In-Text Gene Mentions

…growth regulator 1 (NEGR1), which is one…

Show Full Abstract

A spinal cord injury (SCI) causes changes in brain structure and brain function due to the direct effects of nerve damage, secondary mechanisms, and long-term effects of the injury, such as paralysis and neuropathic pain (NP). Recovery takes place over weeks to months, which is a time frame well beyond the duration of spinal shock and is the phase in which the spinal cord remains unstimulated below the level of injury and is associated with adaptations occurring throughout the nervous system, often referred to as neuronal plasticity. Such changes occur at different anatomical sites and also at different physiological and molecular biological levels. This review aims to investigate brain plasticity in patients with SCIs and its influence on the rehabilitation process. Studies were identified from an online search of the PubMed, Web of Science, and Scopus databases. Studies published between 2013 and 2023 were selected. This review has been registered on OSF under (n) 9QP45. We found that neuroplasticity can affect the sensory-motor network, and different protocols or rehabilitation interventions can activate this process in different ways. Exercise rehabilitation training in humans with SCIs can elicit white matter plasticity in the form of increased myelin water content. This review has demonstrated that SCI patients may experience plastic changes either spontaneously or as a result of specific neurorehabilitation training, which may lead to positive outcomes in functional recovery. Clinical and experimental evidence convincingly displays that plasticity occurs in the adult CNS through a variety of events following traumatic or non-traumatic SCI. Furthermore, efficacy-based, pharmacological, and genetic approaches, alone or in combination, are increasingly effective in promoting plasticity.

NEGR1
Also flagged:Multiple SclerosisMSaxonalgene expressionpathogenesischronic disease of
Journal Article 2024-02-13 ✓ 2 Snippets Cipriano GL, Schepici G, Mazzon E, Anchesi I.
In-Text Gene Mentions

…where circ_HECW2 modulatesneuronal growth regulator 1growth regulator 1…

…growth regulator 1 (NEGR1) expression through miR-30e-5…

Show Full Abstract

Multiple sclerosis (MS) is a degenerative condition characterized by axonal damage and demyelination induced by autoreactive immune cells that occur in the Central Nervous System (CNS). The interaction between epigenetic changes and genetic factors can be widely involved in the onset, development, and progression of the disease. Although numerous efforts were made to discover new therapies able to prevent and improve the course of MS, definitive curative treatments have not been found yet. However, in recent years, it has been reported that non-coding RNAs (ncRNAs), including microRNAs (miRNAs), long ncRNAs (lncRNAs), and circular RNAs (circRNAs), acting as gene expression regulators, could be used as potential therapeutic targets or biomarkers to diagnose and fight MS. In this review, we discussed the role of miRNAs, lncRNAs, and circRNAs, as well as their expression level changes and signaling pathways that are related to preclinical and human MS studies. Hence, the investigation of ncRNAs could be important to provide additional information regarding MS pathogenesis as well as promote the discovery of new therapeutic strategies or biomarkers.

HTT
Also flagged:pathogenesischromosomeHDinheritedpolyglutaminecognitive decline
Journal Article 2024-02-13 ✓ 5 Snippets Pérot JB, Brouillet E, Flament J.
In-Text Gene Mentions

The original zQ175 model has a floxed neomycin resistance cassette (neo cassette) upstream of the Htt gene locus.

HD is dominantly inherited and caused by a unique mutation; an abnormal CAG trinucleotide repeat expansion in the Huntingtin (HTT) gene.

R6/1 is an early transgenic mouse model of HD, expressing the exon 1 of HTT with 116 CAG repeats (Mangiarini et al., 1996) under the promoter of human HTT.

Knock-in models of HD are based on the direct insertion of CAG repeats into the murine htt gene, also called Hdh. Thus, these models are genetically closer to endogenous HD in patients.

Since targeting both normal and mutant HTT alleles might be toxic, considering crucial physiological role of HTT and the fact that a majority of HD gene carriers are heterozygous, new approaches aims at optimizing ASO and other tools to specifically target the mutant allele, and preserving the wild type HTT gene.

Show Full Abstract

Huntington's disease is an inherited disorder characterized by psychiatric, cognitive, and motor symptoms due to degeneration of medium spiny neurons in the striatum. A prodromal phase precedes the onset, lasting decades. Current biomarkers include clinical score and striatal atrophy using Magnetic Resonance Imaging (MRI). These markers lack sensitivity for subtle cellular changes during the prodromal phase. MRI and MR spectroscopy offer different contrasts for assessing metabolic, microstructural, functional, or vascular alterations in the disease. They have been used in patients and mouse models. Mouse models can be of great interest to study a specific mechanism of the degenerative process, allow better understanding of the pathogenesis from the prodromal to the symptomatic phase, and to evaluate therapeutic efficacy. Mouse models can be divided into three different constructions: transgenic mice expressing exon-1 of human huntingtin (HTT), mice with an artificial chromosome expressing full-length human HTT, and knock-in mouse models with CAG expansion inserted in the murine htt gene. Several studies have used MRI/S to characterized these models. However, the multiplicity of modalities and mouse models available complicates the understanding of this rich corpus. The present review aims at giving an overview of results obtained using MRI/S for each mouse model of HD, to provide a useful resource for the conception of neuroimaging studies using mouse models of HD. Finally, despite difficulties in translating preclinical protocols to clinical applications, many biomarkers identified in preclinical models have already been evaluated in patients. This review also aims to cover this aspect to demonstrate the importance of MRI/S for studying HD.

Also flagged:Protein Stumor-palmitoylationtranslationallipidcarbon
Journal Article 2024-02-13 No Snippets Chen Y, Li Y, Wu L.
Show Full Abstract

Protein S-palmitoylation is a reversible post-translational lipid modification that involves the addition of a 16-carbon palmitoyl group to a protein cysteine residue via a thioester linkage. This modification plays a crucial role in the regulation protein localization, accumulation, secretion, stability, and function. Dysregulation of protein S-palmitoylation can disrupt cellular pathways and contribute to the development of various diseases, particularly cancers. Aberrant S-palmitoylation has been extensively studied and proven to be involved in tumor initiation and growth, metastasis, and apoptosis. In addition, emerging evidence suggests that protein S-palmitoylation may also have a potential role in immune modulation. Therefore, a comprehensive understanding of the regulatory mechanisms of S-palmitoylation in tumor cells and the tumor immune microenvironment is essential to improve our understanding of this process. In this review, we summarize the recent progress of S-palmitoylation in tumors and the tumor immune microenvironment, focusing on the S-palmitoylation modification of various proteins. Furthermore, we propose new ideas for immunotherapeutic strategies through S-palmitoylation intervention.

HTT
Also flagged:HeterocyclicHDautosomal dominant progressive neurodegenerative disordercytosineadenineguanine
Journal Article 2024-02-13 ✓ 1 Snippet Sabnis RW, Sabnis AR.
In-Text Gene Mentions

HTT

Show Full Abstract

Provided herein are novel heterocyclic compounds, pharmaceutical compositions, use of such compounds in treating Huntington's disease, and processes for preparing such compounds.

bioRxiv 2024-02-13 Preprint (No Snippets API) Ball G, Oldham S, Kyriakopoulou V, Williams LZJ, Karolis V, Price A, Hutter J, Seal M, Alexander-Bloch A, Hajnal J, Edwards A, Robinson E, Seidlitz J.
Show Full Abstract

The third trimester of human gestation is characterised by rapid increases in brain volume and cortical surface area. A growing catalogue of cells in the prenatal brain has revealed remarkable molecular diversity across cortical areas. 1,2 Despite this, little is known about how this translates into the patterns of differential cortical expansion observed in humans during the latter stages of gestation. Here we present a new resource, μBrain, to facilitate knowledge translation between molecular and anatomical descriptions of the prenatal developing brain. Built using generative artificial intelligence, μBrain is a three-dimensional cellular-resolution digital atlas combining publicly-available serial sections of the postmortem human brain at 21 weeks gestation 3 with bulk tissue microarray data, sampled across 29 cortical regions and 5 transient tissue zones. 4 Using μBrain, we evaluate the molecular signatures of preferentially-expanded cortical regions during human gestation, quantified in utero using magnetic resonance imaging (MRI). We find that differences in the rates of expansion across cortical areas during gestation respect anatomical and evolutionary boundaries between cortical types 5 and are founded upon extended periods of upper-layer cortical neuron migration that continue beyond mid-gestation. We identify a set of genes that are upregulated from mid-gestation and highly expressed in rapidly expanding neocortex, which are implicated in genetic disorders with cognitive sequelae. Our findings demonstrate a spatial coupling between areal differences in the timing of neurogenesis and rates of expansion across the neocortical sheet during the prenatal epoch. The μBrain atlas is available from: https://garedaba.github.io/micro-brain/ and provides a new tool to comprehensively map early brain development across domains, model systems and resolution scales.

Also flagged:recombinase polymeraseantibodiesinfectiongrapheneCRPcell surface
Journal Article 2024-02-12 No Snippets Jankelow A, Chen CL, Cowell TW, Espinosa de Los Monteros J, Bian Z, Kindratenko V, Koprowski K, Darsi S, Han HS, Valera E, Bashir R.
Show Full Abstract

The advancement of point-of-care diagnostics is crucial to improving patient outcomes, especially in areas with low access to hospitals or specialized laboratories. In particular, rapid, sensitive, and multiplexed detection of disease biomarkers has great potential to achieve accurate diagnosis and inform high quality care for patients. Our Coulter counting and immunocapture based detection system has previously shown its broad applicability in the detection of cells, proteins, and nucleic acids. This paper expands the capability of the platform by demonstrating multiplexed detection of whole-virus particles using electrically distinguishable hydrogel beads by demonstrating the capability of our platform to achieve simultaneous detection at clinically relevant concentrations of hepatitis A virus (>2 × 10<sup>3</sup> IU mL<sup>-1</sup>) and human parvovirus B19 virus like particles (>10<sup>6</sup> IU mL<sup>-1</sup>) from plasma samples. The expanded versatility of the differential electrical counting platform allows for more robust and diverse testing capabilities.

NEGR1
Also flagged:Cell surface proteinsextracellulartransmembranelipidpost-translational modificationsmembrane
Journal Article 2024-02-12 ✓ 1 Snippet Lobb-Rabe M, Nawrocka WI, Zhang R, Ashley J, Carrillo RA, Özkan E.
In-Text Gene Mentions

…although one member,Negr1, is cleaved by…

Show Full Abstract

The <i>Drosophila</i> Dpr and DIP proteins belong to the immunoglobulin superfamily of cell surface proteins (CSPs). Their hetero- and homophilic interactions have been implicated in a variety of neuronal functions, including synaptic connectivity, cell survival, and axon fasciculation. However, the signaling pathways underlying these diverse functions are unknown. To gain insight into Dpr-DIP signaling, we sought to examine how these CSPs are associated with the membrane. Specifically, we asked whether Dprs and DIPs are integral membrane proteins or membrane anchored through the addition of glycosylphosphatidylinositol (GPI) linkage. We demonstrate that most Dprs and DIPs are GPI anchored to the membrane of insect cells and validate these findings for some family members in vivo using <i>Drosophila</i> larvae, where GPI anchor cleavage results in loss of surface labeling. Additionally, we show that GPI cleavage abrogates aggregation of insect cells expressing cognate Dpr-DIP partners. To test if the GPI anchor affects Dpr and DIP localization, we replaced it with a transmembrane domain and observed perturbation of subcellular localization on motor neurons and muscles. These data suggest that membrane anchoring of Dprs and DIPs through GPI linkage is required for localization and that Dpr-DIP intracellular signaling likely requires transmembrane coreceptors.

Also flagged:TumortumorsTransient receptor potential vanilloid 1TRPV1capsaicinglutathione
Journal Article 2024-02-12 No Snippets Ngo TL, Wang KL, Pan WY, Ruan T, Lin YJ.
Show Full Abstract

Physical stimulation with mild heat possesses the notable ability to induce immunomodulation within the tumor microenvironment (TME). It transforms the immunosuppressive TME into an immune-active state, making tumors more receptive to immune checkpoint inhibitor (ICI) therapy. Transient receptor potential vanilloid 1 (TRPV1), which can be activated by mild heat, holds the potential to induce these alterations in the TME. However, achieving precise temperature control within tumors while protecting neighboring tissues remains a significant challenge when using external heat sources. Taking inspiration from the heat sensation elicited by capsaicin-containing products activating TRPV1, this study employs capsaicin to chemically stimulate TRPV1, imitating immunomodulatory benefits akin to those induced by mild heat. This involves developing a glutathione (GSH)-responsive immunomodulatory prodrug micelle system to deliver capsaicin and an ICI (BMS202) concurrently. Following intravenous administration, the prodrug micelles accumulate at the tumor site through the enhanced permeability and retention effect. Within the GSH-rich TME, the micelles disintegrate and release capsaicin and BMS202. The released capsaicin activates TRPV1 expressed in the TME, enhancing programmed death ligand 1 expression on tumor cell surfaces and promoting T cell recruitment into the TME, rendering it more immunologically active. Meanwhile, the liberated BMS202 blocks immune checkpoints on tumor cells and T cells, activating the recruited T cells and ultimately eradicating the tumors. This innovative strategy represents a comprehensive approach to fine-tune the TME, significantly amplifying the effectiveness of cancer immunotherapy by exploiting the TRPV1 pathway and enabling <i>in situ</i> control of immunomodulation within the TME.

PEBP1
Also flagged:palmitic acidmetabolismcalcium-oxalate stonesferroptosispathogenesiscalcium
Journal Article 2024-02-12 ✓ 5 Snippets Wang R, Zhang J, Ren H, Qi S, Xie L, Xie H, Shang Z, Liu C.
In-Text Gene Mentions

…binding protein 1 (PEBP1) formed a complex…

…binding protein 1 (PEBP1) and 15-lipoxygenase (15-LO),…

…protein) of mouse anti-PEBP1primary antibody (101,504,…

…formation of thePEBP1/15-LO complex to accelerate…

…formation of thePEBP1/15-LO complex, which signific…

Show Full Abstract

The pathogenesis of renal calcium-oxalate (CaOx) stones is complex and influenced by various metabolic factors. In parallel, palmitic acid (PA) has been identified as an upregulated lipid metabolite in the urine and serum of patients with renal CaOx stones via untargeted metabolomics. Thus, this study aimed to mechanistically assess whether PA is involved in stone formation. Lipidomics analysis of PA-treated renal tubular epithelial cells compared with the control samples revealed that α-linoleic acid and α-linolenic acid were desaturated and elongated, resulting in the formation of downstream polyunsaturated fatty acids (PUFAs). In correlation, the levels of fatty acid desaturase 1 and 2 (FADS1 and FADS2) and peroxisome proliferator-activated receptor α (PPARα) in these cells treated with PA were increased relative to the control levels, suggesting that PA-induced upregulation of PPARα, which in turn upregulated these two enzymes, forming the observed PUFAs. Lipid peroxidation occurred in these downstream PUFAs under oxidative stress and Fenton Reaction. Furthermore, transcriptomics analysis revealed significant changes in the expression levels of ferroptosis-related genes in PA-treated renal tubular epithelial cells, induced by PUFA peroxides. In addition, phosphatidyl ethanolamine binding protein 1 (PEBP1) formed a complex with 15-lipoxygenase (15-LO) to exacerbate PUFA peroxidation under protein kinase C ζ (PKC ζ) phosphorylation, and PKC ζ was activated by phosphatidic acid derived from PA. In conclusion, this study found that the formation of renal CaOx stones is promoted by ferroptosis of renal tubular epithelial cells resulting from PA-induced dysregulation of PUFA and phosphatidic acid metabolism, and PA can promote the renal adhesion and deposition of CaOx crystals by injuring renal tubular epithelial cells, consequently upregulating adhesion molecules. Accordingly, this study provides a new theoretical basis for understanding the correlation between fatty acid metabolism and the formation of renal CaOx stones, offering potential targets for clinical applications.

Also flagged:C-reactive proteintumor necrosis factor-alphaChronic spinalneckanxietydepression
Journal Article 2024-02-12 No Snippets Zhang T, Li X, Zhou X, Zhan L, Wu F, Huang Z, Sun Y, Feng Y, Du Q.
Show Full Abstract

<h4>Background</h4>The effectiveness of virtual reality (VR) therapy in adults with chronic spinal pain (CSP) is unclear.<h4>Objective</h4>This study was conducted to compare the effectiveness of VR therapy and other therapies in adults with CSP, especially patients with inflammation-related pain.<h4>Methods</h4>PubMed, Web of Science, Cochrane Library, Embase, and CINAHL databases were searched up to November 11, 2023. Randomized controlled trials (RCTs) comparing adults with CSP receiving VR therapy with those receiving other therapies were included. The trial registration platform as well as the reference lists of included studies and previous systematic reviews and meta-analyses were manually searched. Two independent reviewers performed study selection, data extraction, risk-of-bias assessment, and evaluation of the quality of the evidence. The weighted mean difference (WMD) was used as the effect size used to synthesize the outcome measure.<h4>Results</h4>In total, 16 RCTs involving 800 participants were included in this meta-analysis. The pooled data from 15 (94%) RCTs including 776 (97%) participants showed that VR therapy was superior in improving pain intensity (WMD=-1.63, 95% CI -2.11 to -1.16, P<.001, I<sup>2</sup>=90%) and reducing inflammatory markers, including C-reactive protein (WMD=-0.89, 95% CI -1.07 to -0.70, P<.001, I<sup>2</sup>=0%), tumor necrosis factor-alpha (WMD=-6.60, 95% CI -8.56 to -4.64, P<.001, I<sup>2</sup>=98%), and interleukin-6 (WMD=-2.76, 95% CI -2.98 to -2.53, P<.001, I<sup>2</sup>=0%). However, no significant differences were found in terms of the spinal range of motion (ROM), disability level, or fear of movement. In addition, 10 (63%) of the included RCTs had a high risk of bias.<h4>Conclusions</h4>VR therapy may be an effective and safe intervention for reducing symptoms in patients with CSP, as it is shown to exert significant analgesic effects and beneficial improvements in inflammatory factor levels. However, this approach may not have significant effects on the spinal ROM, disability level, or fear of movement. Notably, the quality of the evidence from the RCTs included in this study ranged from moderate to low. Therefore, we recommend that readers interpret the results of this study with caution.<h4>Trial registration</h4>PROSPERO CRD42022382331; https://www.crd.york.ac.uk/prospero/display_record.php?RecordID=382331.

Also flagged:Temozolomideneuroendocrine tumorsMGMTsomatostatin receptor subtype-2SSTR2tumor
Journal Article 2024-02-12 No Snippets AghaAmiri S, Ghosh SC, Hernandez Vargas S, Halperin DM, Azhdarinia A.
Show Full Abstract

Temozolomide (TMZ) is a DNA alkylating agent that produces objective responses in patients with neuroendocrine tumors (NETs) when the DNA repair enzyme O<sup>6</sup>-methylguanine-DNA methyltransferase (MGMT) is inactivated. At high doses, TMZ therapy exhausts MGMT activity but also produces dose-limiting toxicities. To reduce off-target effects, we converted the clinically approved radiotracer <sup>68</sup>Ga-DOTA-TOC into a peptide-drug conjugate (PDC) for targeted delivery of TMZ to somatostatin receptor subtype-2 (SSTR2)-positive tumor cells. We used an integrated radiolabeling strategy for direct quantitative assessment of receptor binding, pharmacokinetics, and tissue biodistribution. <i>In vitro</i> studies revealed selective binding to SSTR2-positive cells with high affinity (5.98 ± 0.96 nmol/L), internalization, receptor-dependent DNA damage, cytotoxicity, and MGMT depletion. Imaging and biodistribution analysis showed preferential accumulation of the PDC in receptor-positive tumors and high renal clearance. This study identified a trackable SSTR2-targeting system for TMZ delivery and utilizes a modular design that could be broadly applied in PDC development.

SOX6
Also flagged:SOX8SOX9transcription factorcell proliferationcartilage formationdegenerative cartilage diseases
Journal Article 2024-02-12 ✓ 4 Snippets Molin AN, Contentin R, Angelozzi M, Karvande A, Kc R, Haseeb A, Voskamp C, de Charleroy C, Lefebvre V.
In-Text Gene Mentions

…of SOX5 andSOX6(which form a…

…SOX8 to the SOX5/SOX6/SOX9 chondrogenic group, and…

…for Sox5 andSox6( 54 ,…

…Evidence that unlike SOX5/SOX6, SOX8 does not…

Show Full Abstract

SOX8 was linked in a genome-wide association study to human height heritability, but roles in chondrocytes for this close relative of the master chondrogenic transcription factor SOX9 remain unknown. We undertook here to fill this knowledge gap. High-throughput assays demonstrate expression of human <i>SOX8</i> and mouse <i>Sox8</i> in growth plate cartilage. In situ assays show that <i>Sox8</i> is expressed at a similar level as <i>Sox9</i> in reserve and early columnar chondrocytes and turned off when <i>Sox9</i> expression peaks in late columnar and prehypertrophic chondrocytes. <i>Sox8<sup>-/-</sup></i> mice and <i>Sox8<sup>fl/fl</sup>Prx1Cre</i> and <i>Sox9<sup>fl/+</sup>Prx1Cre</i> mice (inactivation in limb skeletal cells) have a normal or near normal skeletal size. In contrast, juvenile and adult <i>Sox8<sup>fl/fl</sup>Sox9<sup>fl/+</sup>Prx1Cre</i> compound mutants exhibit a 15 to 20% shortening of long bones. Their growth plate reserve chondrocytes progress slowly toward the columnar stage, as witnessed by a delay in down-regulating <i>Pthlh</i> expression, in packing in columns and in elevating their proliferation rate. <i>SOX8</i> or <i>SOX9</i> overexpression in chondrocytes reveals not only that SOX8 can promote growth plate cell proliferation and differentiation, even upon inactivation of endogenous <i>Sox9</i>, but also that it is more efficient than SOX9, possibly due to greater protein stability. Altogether, these findings uncover a major role for SOX8 and SOX9 in promoting skeletal growth by stimulating commitment of growth plate reserve chondrocytes to actively proliferating columnar cells. Further, by showing that SOX8 is more chondrogenic than SOX9, they suggest that SOX8 could be preferred over SOX9 in therapies to promote cartilage formation or regeneration in developmental and degenerative cartilage diseases.

PTGIS
Also flagged:HNF4αPeli1fatty acidoxidationmyocardial hypertrophyHepatocyte nuclear factor 4alpha
Journal Article 2024-02-12 ✓ 1 Snippet Hou Y, Shi P, Du H, Zhu C, Tang C, Que L, Zhu G, Liu L, Chen Q, Li C, Shao G, Li Y, Li J.
In-Text Gene Mentions

…expression of Ch25h,Ptgis, Soat1, Cyp46a1, and…

Show Full Abstract

Impaired fatty acid oxidation (FAO) is a prominent feature of metabolic remodeling observed in pathological myocardial hypertrophy. Hepatocyte nuclear factor 4alpha (HNF4α) is closely associated with FAO in both cellular processes and disease conditions. Pellino 1 (Peli1), an E3 ligase containing a RING-like domain, plays a crucial role in catalyzing polyubiquitination of various substrates. In this study, we aimed to investigate the involvement of HNF4α and its ubiquitination, facilitated by Peli1, in FAO during pressure overload-induced cardiac hypertrophy. Peli1 systemic knockout mice (Peli1<sup>KO</sup>) display improved myocardial hypertrophy and cardiac function following transverse aortic constriction (TAC). RNA-seq analysis revealed that changes in gene expression related to lipid metabolism caused by TAC were reversed in Peli1<sup>KO</sup> mice. Importantly, both HNF4α and its downstream genes involved in FAO showed a significant increase in Peli1<sup>KO</sup> mice. We further used the antagonist BI6015 to inhibit HNF4α and delivered rAAV9-HNF4α to elevate myocardial HNF4α level, and confirmed that HNF4α inhibits the development of cardiac hypertrophy after TAC and is essential for the enhancement of FAO mediated by Peli1 knockout. In vitro experiments using BODIPY incorporation and FAO stress assay demonstrated that HNF4α enhances FAO in cardiomyocytes stimulated with angiotension II (Ang II), while Peli1 suppresses the effect of HNF4α. Mechanistically, immunoprecipitation and mass spectrometry analyses confirmed that Peli1 binds to HNF4α via its RING-like domain and promotes HNF4α ubiquitination at residues K307 and K309. These findings shed light on the underlying mechanisms contributing to impaired FAO and offer valuable insights into a promising therapeutic strategy for addressing pathological cardiac hypertrophy.

Also flagged:Depressiongene expressionmethioninedepressive disorderDepressive disordersamino acid
Journal Article 2024-02-12 No Snippets Khandia R, Gurjar P, Kamal MA, Greig NH.
Show Full Abstract

Depression negatively impacts mood, behavior, and mental and physical health. It is the third leading cause of suicides worldwide and leads to decreased quality of life. We examined 18 genes available at the genetic testing registry (GTR) from the National Center for Biotechnological Information to investigate molecular patterns present in depression-associated genes. Different genotypes and differential expression of the genes are responsible for ensuing depression. The present study, investigated codon pattern analysis, which might play imperative roles in modulating gene expression of depression-associated genes. Of the 18 genes, seven and two genes tended to up- and down-regulate, respectively, and, for the remaining genes, different genotypes, an outcome of SNPs were responsible alone or in combination with differential expression for different conditions associated with depression. Codon context analysis revealed the abundance of identical GTG-GTG and CTG-CTG pairs, and the rarity of methionine-initiated codon pairs. Information based on codon usage, preferred codons, rare, and codon context might be used in constructing a deliverable synthetic construct to correct the gene expression level of the human body, which is altered in the depressive state. Other molecular signatures also revealed the role of evolutionary forces in shaping codon usage.

SOX6
Also flagged:Chronic kidney diseaseend-stage renal diseaseESRDkidney diseaseacute kidney injuryphosphatidylserine receptor KIM1
Journal Article 2024-02-12 ✓ 2 Snippets Ledru N, Wilson PC, Muto Y, Yoshimura Y, Wu H, Li D, Asthana A, Tullius SG, Waikar SS, Orlando G, Humphreys BD.
In-Text Gene Mentions

…FOXP1, HIVEP2, andSOX6.…

…GLIS3, TCF12, FOXP1,SOX6, NFAT5, CREB5, MEF2A,…

Show Full Abstract

Renal proximal tubule epithelial cells have considerable intrinsic repair capacity following injury. However, a fraction of injured proximal tubule cells fails to undergo normal repair and assumes a proinflammatory and profibrotic phenotype that may promote fibrosis and chronic kidney disease. The healthy to failed repair change is marked by cell state-specific transcriptomic and epigenomic changes. Single nucleus joint RNA- and ATAC-seq sequencing offers an opportunity to study the gene regulatory networks underpinning these changes in order to identify key regulatory drivers. We develop a regularized regression approach to construct genome-wide parametric gene regulatory networks using multiomic datasets. We generate a single nucleus multiomic dataset from seven adult human kidney samples and apply our method to study drivers of a failed injury response associated with kidney disease. We demonstrate that our approach is a highly effective tool for predicting key cis- and trans-regulatory elements underpinning the healthy to failed repair transition and use it to identify NFAT5 as a driver of the maladaptive proximal tubule state.

Also flagged:hypertensive crisisBevacizumabcancerhypertensionbreast cancerinvasive
Journal Article 2024-02-12 No Snippets Shen F, Jiang G, Philips S, Cantor E, Gardner L, Xue G, Cunningham G, Kassem N, O'Neill A, Cameron D, Suter TM, Miller KD, Sledge GW, Schneider BP.
Show Full Abstract

<h4>Background</h4>Bevacizumab is a beneficial therapy in several advanced cancer types. Predictive biomarkers to better understand which patients are destined to benefit or experience toxicity are needed. Associations between bevacizumab induced hypertension and survival have been reported but with conflicting conclusions.<h4>Methods</h4>We performed post-hoc analyses to evaluate the association in 3124 patients from two phase III adjuvant breast cancer trials, E5103 and BEATRICE. Differences in invasive disease-free survival (IDFS) and overall survival (OS) between patients with hypertension and those without were compared. Hypertension was defined as systolic blood pressure (SBP) ≥ 160 mmHg (n = 346) and SBP ≥ 180 mmHg (hypertensive crisis) (n = 69). Genomic analyses were performed to evaluate germline genetic predictors for the hypertensive crisis.<h4>Results</h4>Hypertensive crisis was significantly associated with superior IDFS (p = 0.015) and OS (p = 0.042), but only IDFS (p = 0.029; HR = 0.28) remained significant after correction for prognostic factors. SBP ≥ 160 mmHg was not associated with either IDFS or OS. A common single-nucleotide polymorphism, rs6486785, was significantly associated with hypertensive crisis (p = 8.4 × 10<sup>-9</sup>; OR = 5.2).<h4>Conclusion</h4>Bevacizumab-induced hypertensive crisis is associated with superior outcomes and rs6486785 predicted an increased risk of this key toxicity.

Also flagged:ABCC4glioblastomaPKGCyclic nucleotidescyclic nucleotideglioma
Journal Article 2024-02-12 No Snippets Chiang JY, Wei ST, Chang HJ, Chen DC, Wang HL, Lei FJ, Wei KY, Huang YC, Wang CC, Hsieh CH.
Show Full Abstract

<h4>Background</h4>Cyclic nucleotides are critical mediators of cellular signalling in glioblastoma. However, the clinical relevance and mechanisms of regulating cyclic nucleotides in glioblastoma progression and recurrence have yet to be thoroughly explored.<h4>Methods</h4>In silico, mRNA, and protein level analyses identified the primary regulator of cyclic nucleotides in recurrent human glioblastoma. Lentiviral and pharmacological manipulations examined the functional impact of cyclic nucleotide signalling in human glioma cell lines and primary glioblastoma cells. An orthotopic xenograft mice model coupled with aspirin hydrogels verified the in vivo outcome of targeting cyclic nucleotide signalling.<h4>Results</h4>Elevated intracellular levels of cGMP, instead of cAMP, due to a lower substrate efflux from ATP-binding cassette sub-family C member 4 (ABCC4) is engaged in the recurrence of glioblastoma. ABCC4 gene expression is negatively associated with recurrence and overall survival outcomes in glioblastoma specimens. ABCC4 loss-of-function activates cGMP-PKG signalling, promoting malignancy in glioblastoma cells and xenografts. Hydrogels loaded with aspirin, inhibiting glioblastoma progression partly by upregulating ABCC4 expressions, augment the efficacy of standard-of-care therapies in orthotopic glioblastoma xenografts.<h4>Conclusion</h4>ABCC4, repressing the cGMP-PKG signalling pathway, is a tumour suppressor in glioblastoma progression and recurrence. Aspirin hydrogels impede glioblastoma progression through ABCC4 restoration and constitute a viable translational approach.

SERPINC1
Also flagged:secretionhemostasisATtype I AT protein deficiencylocalizationamino acid
Journal Article 2024-02-12 ✓ 5 Snippets Ruf M, Cunningham S, Wandersee A, Brox R, Achenbach S, Strobel J, Hackstein H, Schneider S.
In-Text Gene Mentions

The c.1247dupC mutation results in a frameshift in the CDS of the SERPINC1 gene and a subsequently altered amino acid sequence (p.Ser417LysfsTer48).

SERPINC1 c.1247dupC: a novel SERPINC1 gene mutation associated with familial thrombosis results in a secretion defect and quantitative antithrombin deficiency

SERPINC1c.1247dupC: a novel…

…c.1247dupC: a novelSERPINC1gene mutation associated…

…of an inheritedSERPINC1mutation.…

Show Full Abstract

<h4>Background</h4>Antithrombin (AT) is an important anticoagulant in hemostasis. We describe here the characterization of a novel AT mutation associated with clinically relevant thrombosis. A pair of sisters with confirmed type I AT protein deficiency was genetically analyzed on suspicion of an inherited SERPINC1 mutation. A frameshift mutation, c.1247dupC, was identified and the effect of this mutation was examined on the cellular and molecular level.<h4>Methods</h4>Plasmids for the expression of wild-type (WT) and mutated SERPINC1 coding sequence (CDS) fused to green fluorescent protein (GFP) or hemagglutinin (HA) tag were transfected into HEK293T cells. Subcellular localization and secretion of the respective fusion proteins were analyzed by confocal laser scanning microscopy and Western blot.<h4>Results</h4>The c.1247dupC mutation results in a frameshift in the CDS of the SERPINC1 gene and a subsequently altered amino acid sequence (p.Ser417LysfsTer48). This alteration affects the C-terminus of the AT antigen and results in impaired secretion as confirmed by GFP- and HA-tagged mutant AT analyzed in HEK293T cells.<h4>Conclusion</h4>The p.Ser417LysfsTer48 mutation leads to impaired secretion, thus resulting in a quantitative AT deficiency. This is in line with the type I AT deficiency observed in the patients.

HTT
Also flagged:post-translational modificationssynthesisphosphorylationneurodegenerative diseasesdeathbeta-amyloid protein
Journal Article 2024-02-12 ✓ 5 Snippets Li W, Li HL, Wang JZ, Liu R, Wang X.
In-Text Gene Mentions

HD, a genetic neurodegenerative disease, is thought to be associated with abnormal modifications of huntingtin protein (HTT), which may play a critical role in the pathogenesis of HD.

Mali Jiang et al. discovered that Nemo-like kinase (NLK) interacts with HTT and that NLK levels are significantly reduced in HD human brain and HD models, demonstrating that NLK overexpression in the striatum reduces brain atrophy and mutant HTT(mHTT) aggregation in HD mice, lowers mHTT levels in a kinase activity-dependent manner while having no significant effect on normal HTT protein levels, and promotes mHTT ubiquitination and degradation via the proteasome pathway, suggesting a protective role of NLK in HD and identifying a new molecular target to reduce mHTT levels [86].

Abnormal aggregation of HTT is a major pathological feature of HD, with ubiquitination being an important mechanism for HTT degradation, and Nelma M. Palminha et al. discovered that defective repair of topoisomerase I induced chromosomal damage in HD is due to reduced H2A ubiquitination resulting from limited RNF168 activity, which is caused by increased interaction with p62, and that depletion of p62 or disruption of the interaction between RNF168 and p62 is sufficient to restore 53BP1 enrichment and subsequent DNA repair in HD models, presenting new possibilities for therapeutic interventions [79].

Leah Gottlieb et al. discovered that N-alpha-acetylation of HTT increases its propensity to aggregate, which has implications for HD since aggregation of HTT is associated with the disease, and the study suggests that targeting NatA-mediated Htt acetylation could be a promising therapeutic approach in HD [73].

Fanny L. Lemarié et al. reveals that HTT is palmitoylated at multiple sites and post-translationally myristoylated following caspase cleavage, and that blocking caspase cleavage at the critical and pathogenic aspartate 586 significantly increases posttranslational myristoylation of huntingtin, promoting the co-interaction between C-terminal and N-terminal huntingtin fragments and providing a protective effect [87].

Show Full Abstract

Protein post-translational modifications (PPTMs) refer to a series of chemical modifications that occur after the synthesis of protein. Proteins undergo different modifications such as phosphorylation, acetylation, ubiquitination, and so on. These modifications can alter the protein's structure, function, and interaction, thereby regulating its biological activity. In neurodegenerative diseases, several proteins undergo abnormal post-translational modifications, which leads to aggregation and abnormal deposition of protein, thus resulting in neuronal death and related diseases. For example, the main pathological features of Alzheimer's disease are the aggregation of beta-amyloid protein and abnormal phosphorylation of tau protein. The abnormal ubiquitination and loss of α-synuclein are related to the onset of Parkinson's disease. Other neurodegenerative diseases such as Huntington's disease, amyotrophic lateral sclerosis, and so on are also connected with abnormal PPTMs. Therefore, studying the abnormal PPTMs in neurodegenerative diseases is critical for understanding the mechanism of these diseases and the development of significant therapeutic strategies. This work reviews the implications of PPTMs in neurodegenerative diseases and discusses the relevant therapeutic strategies.

STAU1
Also flagged:FOXA1gene expressionForkhead box A1transcription factorbreast cancercolorectal cancer
Journal Article 2024-02-12 ✓ 5 Snippets Pasterczyk KR, Li XL, Singh R, Zibitt MS, Hartford CCR, Pongor L, Jenkins LM, Hu Y, Zhao PX, Muys BR, Kumar S, Roper N, Aladjem MI, Pommier Y, Grammatikakis I, Lal A.
In-Text Gene Mentions

…trometry identified Staufen1 (STAU1) as a potential…

…Indeed,STAU1knockdown resulted in…

…data, RNA-seq followingSTAU1knockdown in CRC…

…were upregulated uponSTAU1knockdown.…

STAU1

Show Full Abstract

Transcription factors play key roles in development and disease by controlling gene expression. Forkhead box A1 (FOXA1), is a pioneer transcription factor essential for mouse development and functions as an oncogene in prostate and breast cancer. In colorectal cancer (CRC), FOXA1 is significantly downregulated and high FOXA1 expression is associated with better prognosis, suggesting potential tumor suppressive functions. We therefore investigated the regulation of FOXA1 expression in CRC, focusing on well-differentiated CRC cells, where FOXA1 is robustly expressed. Genome-wide RNA stability assays identified FOXA1 as an unstable mRNA in CRC cells. We validated FOXA1 mRNA instability in multiple CRC cell lines and in patient-derived CRC organoids, and found that the FOXA1 3'UTR confers instability to the FOXA1 transcript. RNA pulldowns and mass spectrometry identified Staufen1 (STAU1) as a potential regulator of FOXA1 mRNA. Indeed, STAU1 knockdown resulted in increased FOXA1 mRNA and protein expression due to increased FOXA1 mRNA stability. Consistent with these data, RNA-seq following STAU1 knockdown in CRC cells revealed that FOXA1 targets were upregulated upon STAU1 knockdown. Collectively, this study uncovers a molecular mechanism by which FOXA1 is regulated in CRC cells and provides insights into our understanding of the complex mechanisms of gene regulation in cancer.

HFE
Also flagged:IronoxygenmitochondrialIron deficiencybindingferric ions
Journal Article 2024-02-12 ✓ 1 Snippet Arora P, Zheng H, Munusamy S, Jahani R, Wang L, Guan X.
In-Text Gene Mentions

hemochromatosis

Show Full Abstract

Iron is an essential element that plays critical roles in many biological/metabolic processes, ranging from oxygen transport, mitochondrial respiration, to host defense and cell signaling. Maintaining an appropriate iron level in the body is vital to the human health. Iron deficiency or overload can cause life-threatening conditions. Thus, developing a new, rapid, cost-effective, and easy to use method for iron detection is significant not only for environmental monitoring but also for disease prevention. In this study, we report an innovative Fe<sup>3+</sup> detection strategy by using both a ligand probe and an engineered nanopore with two binding sites. In our design, one binding site of the nanopore has a strong interaction with the ligand probe, while the other is more selective toward interfering species. Based on the difference in the number of ligand DTPMPA events in the absence and presence of ferric ions, micromolar concentrations of Fe<sup>3+</sup> could be detected within minutes. Our method is selective: micromolar concentrations of Mg<sup>2+</sup>, Ca<sup>2+</sup>, Cd<sup>2+</sup>, Zn<sup>2+</sup>, Ni<sup>2+</sup>, Co<sup>2+</sup>, Mn<sup>2+</sup>, and Cu<sup>2+</sup> would not interfere with the detection of ferric ions. Furthermore, Cu<sup>2+</sup>, Ni<sup>2+</sup>, Co<sup>2+</sup>, Zn<sup>2+</sup>, and Mn<sup>2+</sup> produced current blockage events with quite different signatures from each other, enabling their simultaneous detection. In addition, simulated water and serum samples were successfully analyzed. The nanopore sensing strategy developed in this work should find useful application in the development of stochastic sensors for other substances, especially in situations where multi-analyte concurrent detection is desired.

Also flagged:bone resorptionOPOsteoporosisbone diseasescalciumdegradation
Journal Article 2024-02-12 No Snippets Wen C, Xu X, Zhang Y, Xia J, Liang Y, Xu L.
Show Full Abstract

Osteoporosis (OP) affects millions of people worldwide, especially postmenopausal women and the elderly. Although current available anti-OP agents can show promise in slowing down bone resorption, most are not specifically delivered to the hard tissue, causing significant toxicity. A bone-targeted nanodrug delivery system can reduce side effects and precisely deliver drug candidates to the bone. This review focuses on the progress of bone-targeted nanoparticles in OP therapy. We enumerate the existing OP medications, types of bone-targeted nanoparticles and categorize pairs of the most common bone-targeting functional groups. Finally, we summarize the potential use of bone-targeted nanoparticles in OP treatment. Ongoing research into the development of targeted ligands and nanocarriers will continue to expand the possibilities of OP-targeted therapies into clinical application.

Also flagged:NF-kappa Bhypoxia-inducible factorepidermal growth factor receptorEGFRtyrosine kinasexanthine dehydrogenase
Journal Article 2024-02-12 No Snippets Qiu M, Zhang J, Wei W, Zhang Y, Li M, Bai Y, Wang H, Meng Q, Guo DA.
Show Full Abstract

Aurantii Fructus (AF) and Aurantii Fructus Immaturus (AFI) have been used for thousands of years as traditional Chinese medicine (TCM) with sedative effects. Modern studies have shown that Citrus plants also have protective effects on the nervous system. However, the effective substances and mechanisms of action in Citrus TCMs still remain unclear. In order to explore the pharmacodynamic profiles of identified substances and the action mechanism of these herbs, a comprehensive approach combining ultra-high-performance liquid chromatography with quadrupole time-of-flight mass spectrometry (UPLC/Q-TOF-MS/MS) analysis and network pharmacology was employed. Firstly, UNIFI 2.1.1 software was used to identify the chemical characteristics of AF and AFI. Secondly, the SwissTargetPrediction database was used to predict the targets of chemical components in AF and AFI. Targets for neuroprotection were also collected from GeneCards: The Human Gene Database (GeneCards-Human Genes|Gene Database|Gene Search). The networks between targets and compounds or diseases were then constructed using Cytoscape 3.9.1. Finally, the Annotation, Visualization and Integrated Discovery Database (DAVID) (DAVID Functional Annotation Bioinformatics Microarray Analysis) was used for GO and pathway enrichment analysis. The results showed that 50 of 188 compounds in AF and AFI may have neuroprotective biological activities. These activities are associated with the regulatory effects of related components on 146 important signaling pathways, derived from the KEGG (KEGG: Kyoto Encyclopedia of Genes and Genomes), such as neurodegeneration (hsa05022), the Alzheimer's disease pathway (hsa05010), the NF-kappa B signaling pathway (hsa04064), the hypoxia-inducible factor (HIF)-1 signaling pathway (hsa04066), apoptosis (hsa04210), the epidermal growth factor receptor (EGFR) tyrosine kinase inhibitor resistance signaling pathway (hsa01521), and others, by targeting 108 proteins, including xanthine dehydrogenase (XDH), glutamate ionotropic receptor NMDA type subunit 2B (GRIN2B), and glucose-6-phosphate dehydrogenase (G6PD), among others. These targets are thought to be related to inflammation, neural function and cell growth.

Also flagged:serine incorporatorSERINCHIV-1 infectionviriongene expressionCell
Journal Article 2024-02-12 No Snippets Sid Ahmed S, Bajak K, Fackler OT.
Show Full Abstract

Members of the serine incorporator (SERINC) protein family exert broad antiviral activity, and many viruses encode SERINC antagonists to circumvent these restrictions. Significant new insight was recently gained into the mechanisms that mediate restriction and antagonism. In this review, we summarize our current understanding of the mode of action and relevance of SERINC proteins in HIV-1 infection. Particular focus will be placed on recent findings that provided important new mechanistic insights into the restriction of HIV-1 virion infectivity, including the discovery of SERINC's lipid scramblase activity and its antagonism by the HIV-1 pathogenesis factor Nef. We also discuss the identification and implications of several additional antiviral activities by which SERINC proteins enhance pro-inflammatory signaling and reduce viral gene expression in myeloid cells. SERINC proteins emerge as versatile and multifunctional regulators of cell-intrinsic immunity against HIV-1 infection.

Also flagged:localizationmethylationsecretionsteroid hormonesgene expressionwater
Journal Article 2024-02-12 No Snippets Xu X, Yang L, Deng X, Xiao Q, Huang X, Wang C, Zhou Y, Luo X, Zhang Y, Xu X, Qin Q, Liu S.
Show Full Abstract

<h4>Introduction</h4>In the Dongting water system, the <i>Carassius auratus</i> (Crucian carp) complex is characterized by the coexistence of diploid forms (2n=100, 2nCC) and polyploidy forms. The diploid (2nCC) and triploid C.auratus (3n=150, 3nCC) had the same fertility levels, reaching sexual maturity at one year.<h4>Methods</h4>The nucleotide sequence, gene expression, methylation, and immunofluorescence of the gonadotropin releasing hormone 2(<i>Gnrh2</i>), Gonadotropin hormone beta(<i>Gthβ</i>), and Gonadotropin-releasing hormone receptor(<i>Gthr</i>) genes pivotal genes of the hypothalamic-pituitary-gonadal (HPG) axis were analyzed.<h4>Results</h4>The analysis results indicated that <i>Gnrh2</i>, follicle-stimulating hormone receptor(<i>Fshr</i>), and Lethal hybrid rescue(<i>Lhr</i>) genes increased the copy number and distinct structural differentiation in 3nCC compared to that in 2nCC. The transcript levels of HPG axis genes in 3nCC were higher than 2nCC (P<0.05), which could promote the production and secretion of sex steroid hormones conducive to the gonadal development of 3nCC. Meanwhile, the DNA methylation levels in the promoter regions of the HPG axis genes were lower in 3nCC than in 2nCC. These results suggested that methylation of the promoter region had a potential regulatory effect on gene expression after triploidization. Immunofluorescence showed that the localization of the <i>Fshβ, Lhβ</i>, and <i>Fshr</i> genes between 3nCC and 2nCC remained unchanged, ensuring the normal expression of these genes at the corresponding sites after triploidization.<h4>Discussion</h4>Relevant research results provide cell and molecular biology evidence for normal reproductive activities such as gonad development and gamete maturation in triploid <i>C. auratus</i>, and contribute to further understanding of the genetic basis for fertility restoration in triploid <i>C. auratus</i>.

Also flagged:Multisystem Inflammatory SyndromeC-reactive proteinSARS-CoV-2 infectionCOVID-19immune dysregulationendothelial dysfunction
Journal Article 2024-02-12 No Snippets Fink EL, Alcamo AM, Lovett M, Hartman M, Williams C, Garcia A, Rasmussen L, Pal R, Drury K, MackDiaz E, Ferrazzano PA, Dervan L, Appavu B, Snooks K, Stulce C, Rubin P, Pate B, Toney N, Robertson CL, Wainwright MS, Roa JD, Schober ME, Slomine BS.
Show Full Abstract

<h4>Introduction</h4>Hospitalized children diagnosed with SARS-CoV-2-related conditions are at risk for new or persistent symptoms and functional impairments. Our objective was to analyze post-hospital symptoms, healthcare utilization, and outcomes of children previously hospitalized and diagnosed with acute SARS-CoV-2 infection or Multisystem Inflammatory Syndrome in Children (MIS-C).<h4>Methods</h4>Prospective, multicenter electronic survey of parents of children <18 years of age surviving hospitalization from 12 U.S. centers between January 2020 and July 2021. The primary outcome was a parent report of child recovery status at the time of the survey (recovered vs. not recovered). Secondary outcomes included new or persistent symptoms, readmissions, and health-related quality of life. Multivariable backward stepwise logistic regression was performed for the association of patient, disease, laboratory, and treatment variables with recovered status.<h4>Results</h4>The children [<i>n</i> = 79; 30 (38.0%) female] with acute SARS-CoV-2 (75.7%) or MIS-C (24.3%) had a median age of 6.5 years (interquartile range 2.0-13.0) and 51 (64.6%) had a preexisting condition. Fifty children (63.3%) required critical care. One-third [23/79 (29.1%)] were not recovered at follow-up [43 (31, 54) months post-discharge]. Admission C-reactive protein levels were higher in children not recovered vs. recovered [5.7 (1.3, 25.1) vs. 1.3 (0.4, 6.3) mg/dl, <i>p</i> = 0.02]. At follow-up, 67% overall had new or persistent symptoms. The most common symptoms were fatigue (37%), weakness (25%), and headache (24%), all with frequencies higher in children not recovered. Forty percent had at least one return emergency visit and 24% had a hospital readmission. Recovered status was associated with better total HRQOL [87 (77, 95) vs. 77 (51, 83), <i>p</i> = 0.01]. In multivariable analysis, lower admission C-reactive protein [odds ratio 0.90 (95% confidence interval 0.82, 0.99)] and higher admission lymphocyte count [1.001 (1.0002, 1.002)] were associated with recovered status.<h4>Conclusions</h4>Children considered recovered by their parents following hospitalization with SARS-CoV-2-related conditions had less symptom frequency and better HRQOL than those reported as not recovered. Increased inflammation and lower lymphocyte count on hospital admission may help to identify children needing longitudinal, multidisciplinary care.<h4>Clinical trial registration</h4>ClinicalTrials.gov (NCT04379089).

ZNFX1
Also flagged:immune responseswatergene-expressioncytokineil1bacute-phase
Journal Article 2024-02-12 ✓ 3 Snippets van Muilekom DR, Mueller J, Lindemeyer J, Schultheiß T, Maser E, Seibel H, Rebl A, Schulz C, Goldammer T.
In-Text Gene Mentions

…We found that in the head kidney, the genes dominating the overall gene-expression pattern were mainly involved in antiviral defense ( ifit5 , isg15 , rsad2 ,znfx1), and additionally in anti-oxidant activity ( cat ), antimicrobial defense ( mpo ) and Th1 immunity ( il18 ).…

…Moreover, in addition to antiviral genes ( isg15 , rsad2 ,znfx1, ifit5 ), lao1 was also reduced merely 2 weeks after SWT.…

…In this study, expression of several immune-genes ( c1ql2, fcgr1a, hamp, ifit5, il1b, isg15, rsad2 ) was reduced in the gill while in the head kidney both an induction ( camp, drtp1, saa5 ) and reduction ( ifit5, isg15, lao1, sod1,znfx1) of genes was observed after salinity change.…

Show Full Abstract

Smoltification was found to impact both immune and stress responses of farmed Atlantic salmon (<i>Salmo salar</i>), but little is known about how salinity change affects salmon months after completed smoltification. Here, we examined (1) the effect of salinity change from brackish water to seawater on the stress and immune responses in Atlantic salmon and (2) evaluated if functional diets enriched with microalgae can mitigate stress- and immune-related changes. Groups of Atlantic salmon were fed for 8 weeks with different microalgae-enriched diets in brackish water and were then transferred into seawater. Samples of the head kidney, gill, liver and plasma were taken before seawater transfer (SWT), 20 h after SWT, and 2 weeks after SWT for gene-expression analysis, plasma biochemistry and protein quantification. The salmon showed full osmoregulatory ability upon transfer to seawater reflected by high <i>nkaα1b</i> levels in the gill and tight plasma ion regulation. In the gill, one-third of 44 investigated genes were reduced at either 20 h or 2 weeks in seawater, including genes involved in cytokine signaling (<i>il1b</i>) and antiviral defense (<i>isg15, rsad2, ifit5</i>). In contrast, an acute response after 20 h in SW was apparent in the head kidney reflected by increased plasma stress indicators and induced expression of genes involved in acute-phase response (<i>drtp1</i>), antimicrobial defense (<i>camp</i>) and stress response (<i>hspa5</i>). However, after 2 weeks in seawater, the expression of antiviral genes (<i>isg15, rsad2, znfx1</i>) was reduced in the head kidney. Few genes (<i>camp, clra, c1ql2</i>) in the gill were downregulated by a diet with 8% inclusion of <i>Athrospira platensis</i>. The results of the present study indicate that salinity change months after smoltification evokes molecular stress- and immune responses in Atlantic salmon. However, microalgae-enriched functional diets seem to have only limited potential to mitigate the related changes.

bioRxiv 2024-02-12 Preprint (No Snippets API) Okonechnikov K, Joshi P, Körber V, Rademacher A, Bortolomeazzi M, Mallm J, da Silva PBG, Statz B, Sepp M, Sarropoulos I, Yamada-Saito T, Vaillant J, Wittmann A, Schramm K, Blattner-Johnson M, Fiesel P, Jones B, Milde T, Pajtler K, van Tilburg CM, Witt O, Bochennek K, Weber KJ, Nonnenmacher L, Reimann C, Schüller U, Mynarek M, Rutkowski S, Jones DT, Korshunov A, Rippe K, Westermann F, Thongjuea S, Höfer T, Kaessmann H, Kutscher LM, Pfister SM.
Show Full Abstract

Despite recent advances in understanding disease biology, treatment of Group 3/4 medulloblastoma remains a therapeutic challenge in pediatric neuro-oncology. Bulk-omics approaches have identified considerable intertumoral heterogeneity in Group 3/4 medulloblastoma, including the presence of clear single-gene oncogenic drivers in only a subset of cases, whereas in the majority of cases, large-scale copy-number aberrations prevail. However, intratumoral heterogeneity, the role of oncogene aberrations, and broad CNVs in tumor evolution and treatment resistance remain poorly understood. To dissect this interplay, we used single-cell technologies (snRNA-seq, snATAC-seq, spatial transcriptomics) on a cohort of Group 3/4 medulloblastoma with known alterations in the oncogenes MYC, MYCN , and PRDM6 . We show that large-scale chromosomal aberrations are early tumor initiating events, while the single-gene oncogenic events arise late and are typically sub-clonal, but MYC can become clonal upon disease progression to drive further tumor development and therapy resistance. We identify that the subclones are mostly interspersed across tumor tissue using spatial transcriptomics, but clear segregation is also present. Using a population genetics model, we estimate medulloblastoma initiation in the cerebellar unipolar brush cell-lineage starting from the first gestational trimester. Our findings demonstrate how single-cell technologies can be applied for early detection and diagnosis of this fatal disease.

Research Square 2024-02-12 Preprint (No Snippets API) Čižaitė R, Žukauskaitė G, Tumienė B.
Show Full Abstract

<title>Abstract</title> <p>Infertility is a complex pathological condition that affects the male population worldwide. Male infertility is often caused by changes in the morphology and number of spermatozoa. Many of infertility cases remain unexplained, genetic causes are being discovered, including changes in chromosomes and single genes. While Y chromosome microdeletions are the most common cause of spermatogenesis disorders, failure to identify them leads to the search for new candidate genes, <italic>de novo</italic> pathogenic genomic variants associated with male infertility using next generation sequencing. The aim of this study is to investigate genetic profile of infertile men in the Lithuanian population using candidate gene approach as well as to evaluate the significance of partial Y chromosome microdeletions. The obtained results showed that the detected partial Y chromosome (sY121, sY1192, sY153 and sY1191 markers) microdeletions in the azoospermia factor region do not explain infertility cases and require more research. After candidate-gene next generation sequencing analysis in the cohort of 18 infertile men from Lithuania, genome variants in genes <italic>DPY19L2, DCC</italic>, and <italic>MTHFR</italic> were identified for three (17%) individuals, confirming the infertility phenotype. In five (28%) of individuals variants of uncertain clinical significance were identified in <italic>BRCA1</italic>, <italic>BRCA2</italic>, <italic>PKD1</italic>, <italic>CSMD1</italic>, <italic>SBF1</italic>, <italic>DNAH8</italic>, and <italic>TP63</italic> genes, which are potentially associated with male infertility. This confirms that the next generation method based on the supplemented gene candidate list is useful for the identification of genetic causes of male infertility.</p>

Also flagged:tumorextracellularmineralizationcollagen type Imineralglycocalyx
Journal Article 2024-02-11 No Snippets Park S, Choi S, Shimpi AA, Estroff LA, Fischbach C, Paszek MJ.
Show Full Abstract

Skeletal metastasis is common in patients with advanced breast cancer and often caused by immune evasion of disseminated tumor cells (DTCs). In the skeleton, tumor cells not only disseminate to the bone marrow but also to osteogenic niches in which they interact with newly mineralizing bone extracellular matrix (ECM). However, it remains unclear how mineralization of collagen type I, the primary component of bone ECM, regulates tumor-immune cell interactions. Here, a combination of synthetic bone matrix models with controlled mineral content, nanoscale optical imaging, and flow cytometry are utilized to evaluate how collagen type I mineralization affects the biochemical and biophysical properties of the tumor cell glycocalyx, a dense layer of glycosylated proteins and lipids decorating their cell surface. These results suggest that collagen mineralization upregulates mucin-type O-glycosylation and sialylation by tumor cells, which increases their glycocalyx thickness while enhancing resistance to attack by natural killer (NK) cells. These changes are functionally linked as treatment with a sialylation inhibitor decreased mineralization-dependent glycocalyx thickness and made tumor cells more susceptible to NK cell attack. Together, these results suggest that interference with glycocalyx sialylation may represent a therapeutic strategy to enhance cancer immunotherapies targeting bone-metastatic breast cancer.

SERPINC1
Also flagged:veincoronavirus disease 2019 infectioncoronavirus disease 2019hemicentral retinal vein occlusionretinal vein occlusionvision
Journal Article 2024-02-11 ✓ 1 Snippet Riazi-Esfahani H, Sadeghi R, Soleymanzadeh M, Farrokhpour H, Bazvand F, Ebrahimiadib N, Khalili Pour E, Mirghorbani M.
In-Text Gene Mentions

…screen), LAC-sensitive PTT,antithrombin-III, lupus anticoagulant silica…

Show Full Abstract

<h4>Background</h4>Considering the various manifestations of coronavirus disease 2019 and its imperative importance in terms of the right clinical approach and early management, we sought to present a hemicentral retinal vein occlusion case, with a history of heterozygosity of methylenetetrahydrofolate reductase (MTHFR) genes and potential for clotting complications as a late manifestation of coronavirus disease 2019, and provide a brief review of reported retinal vein occlusion cases in patients with coronavirus disease 2019.<h4>Case presentation</h4>A 35-year-old Iranian patient presented with a visual impairment in the left eye 4 months after recovering from coronavirus disease 2019. He reported a mild blurring of vision in the same eye a few days after admission due to coronavirus disease 2019. The ophthalmic evaluation was compatible with hemicentral retinal vein occlusion. Systemic and laboratory workups were negative except for borderline protein C activity, homocysteine levels, and heterozygosity of MTHFR genes. The patient was scheduled to receive three monthly intravitreal antivascular endothelial growth factor injections.<h4>Conclusion</h4>We present a case of inferior hemicentral retinal vein occlusion case with an MTHFR mutation with sequential loss of vision 4 months after coronavirus disease 2019 to make clinicians aware of the possibility of late ocular coronavirus disease 2019 manifestations.

Also flagged:multiple sclerosisMSchronic neurological disordersneurological diseasesPDAD
Journal Article 2024-02-11 No Snippets Harding KE, Kreft KL, Ben-Shlomo Y, Robertson NP.
Show Full Abstract

A multiple sclerosis (MS) prodrome has recently been described and is characterised by increased rates of healthcare utilisation and an excess frequency of fatigue, bladder problems, sensory symptoms and pain, in the years leading up to clinical onset of disease. This important observation may have several potential applications including in the identification of risk factors for disease, the potential to delay or prevent disease onset and early opportunities to alter disease course. It may also offer possibilities for the use of risk stratification algorithms and effective population screening. If standardised, clearly defined and disease specific, an MS prodrome is also likely to have a profound influence on research and clinical trials directed at the earliest stages of disease. In order to achieve these goals, it is essential to consider experience already gleaned from other disorders. More specifically, in some chronic neurological disorders the understanding of disease pro-drome is now well advanced and has been successfully applied. However, understanding of the MS prodrome remains at an early stage with key questions including the length of the prodrome, symptom specificity and potential benefits of early intervention as yet unanswered. In this review we will explore the evidence available to date and suggest future research strategies to address unanswered questions. In addition, whilst current understanding of the MS prodrome is not yet sufficient to justify changes in public health policy or MS management, we will consider the practical utility and future application of the MS prodrome in a wider health care setting.

SOX6
Also flagged:CB1 Receptorcannabinoid type 1 receptorCB1mitochondrialComplex IComplex IV
Journal Article 2024-02-11 ✓ 5 Snippets Senese R, Petito G, Silvestri E, Ventriglia M, Mosca N, Potenza N, Russo A, Manfrevola F, Cobellis G, Chioccarelli T, Porreca V, Mele VG, Chianese R, de Lange P, Ricci G, Cioffi F, Lanni A.
In-Text Gene Mentions

…Factor 6 (sox6), and Regulator…

…genes, such assox6, rod1 ,…

…repression of thesox6and rod1 genes…

Sox6and rod1 exhibited…

…translational repression ofsox6and rod1 genes…

Show Full Abstract

This study aims to explore the complex role of cannabinoid type 1 receptor (CB1) signaling in the gastrocnemius muscle, assessing physiological processes in both CB1<sup>+/+</sup> and CB1<sup>-/-</sup> mice. The primary focus is to enhance our understanding of how CB1 contributes to mitochondrial homeostasis. At the tissue level, CB1<sup>-/-</sup> mice exhibit a substantial miRNA-related alteration in muscle fiber composition, characterized by an enrichment of oxidative fibers. CB1 absence induces a significant increase in the oxidative capacity of muscle, supported by elevated in-gel activity of Complex I and Complex IV of the mitochondrial respiratory chain. The increased oxidative capacity is associated with elevated oxidative stress and impaired antioxidant defense systems. Analysis of mitochondrial biogenesis markers indicates an enhanced capacity for new mitochondria production in CB1<sup>-/-</sup> mice, possibly adapting to altered muscle fiber composition. Changes in mitochondrial dynamics, mitophagy response, and unfolded protein response (UPR) pathways reveal a dynamic interplay in response to CB1 absence. The interconnected mitochondrial network, influenced by increased fusion and mitochondrial UPR components, underlines the dual role of CB1 in regulating both protein quality control and the generation of new mitochondria. These findings deepen our comprehension of the CB1 impact on muscle physiology, oxidative stress, and MQC processes, highlighting cellular adaptability to CB1<sup>-/-</sup>. This study paves the way for further exploration of intricate signaling cascades and cross-talk between cellular compartments in the context of CB1 and mitochondrial homeostasis.

Also flagged:PLAG1VRTNPRKG2NR6A1LTBP2DCAF7
Journal Article 2024-02-11 No Snippets Khan MZ, Chen W, Huang B, Liu X, Wang X, Liu Y, Chai W, Wang C.
Show Full Abstract

In livestock breeding, the number of vertebrae has gained significant attention due to its impact on carcass quality and quantity. Variations in vertebral traits have been observed across different animal species and breeds, with a strong correlation to growth and meat production. Furthermore, vertebral traits are classified as quantitative characteristics. Molecular marker techniques, such as marker-assisted selection (MAS), have emerged as efficient tools to identify genetic markers associated with vertebral traits. In the current review, we highlight some key potential genes and their polymorphisms that play pivotal roles in controlling vertebral traits (development, length, and number) in various livestock species, including pigs, donkeys, and sheep. Specific genetic variants within these genes have been linked to vertebral development, number, and length, offering valuable insights into the genetic mechanisms governing vertebral traits. This knowledge has significant implications for selective breeding strategies to enhance structural characteristics and meat quantity and quality in livestock, ultimately improving the efficiency and quality of the animal husbandry industry.

HTT
Also flagged:neurodegenerative disorderHDgene expressioncholesterolsterolmetabolism
Journal Article 2024-02-11 ✓ 5 Snippets Olechnowicz A, Blatkiewicz M, Jopek K, Isalan M, Mielcarek M, Rucinski M.
In-Text Gene Mentions

HD is caused by CAG expansion within the huntingtin gene (HTT) located on chromosome 4 [5,6].

Considering the widespread expression of HTT in virtually all tissues [11,12], it is reasonable to infer that symptoms or functional changes related to HD can also manifest in multiple organs [13,14].

…huntingtin gene (HTT) located on…

…widespread expression ofHTTin virtually all…

…the expression ofHttand Htt -related…

Show Full Abstract

Huntington's disease (HD) is a neurodegenerative disorder that affects mainly the central nervous system (CNS) by inducing progressive deterioration in both its structure and function. In recent years, there has been growing interest in the impact of HD on peripheral tissue function. Herein, we used the R6/2 mouse model of HD to investigate the influence of the disease on adrenal gland functioning. A transcriptomic analysis conducted using a well-established quantitative method, an Affymetrix array, revealed changes in gene expression in the R6/2 model compared to genetic background controls. For the first time, we identified disruptions in cholesterol and sterol metabolism, blood coagulation, and xenobiotic metabolism in HD adrenal glands. This study showed that the disrupted expression of these genes may contribute to the underlying mechanisms of Huntington's disease. Our findings may contribute to developing a better understanding of Huntington's disease progression and aid in the development of novel diagnostic or therapeutic approaches.

Also flagged:PlatinumIndoleAcetic Acidcisplatinoxaliplatincarboplatin
Journal Article 2024-02-11 No Snippets Aputen AD, Elias MG, Gilbert J, Sakoff JA, Gordon CP, Scott KF, Aldrich-Wright JR.
Show Full Abstract

Kinetically inert platinum(IV) complexes are a chemical strategy to overcome the impediments of standard platinum(II) antineoplastic drugs like cisplatin, oxaliplatin and carboplatin. In this study, we reported the syntheses and structural characterisation of three platinum(IV) complexes that incorporate 5-benzyloxyindole-3-acetic acid, a bioactive ligand that integrates an indole pharmacophore. The purity and chemical structures of the resultant complexes, <b>P-5B3A</b>, <b>5-5B3A</b> and <b>56-5B3A</b> were confirmed via spectroscopic means. The complexes were evaluated for anticancer activity against multiple human cell lines. All complexes proved to be considerably more active than cisplatin, oxaliplatin and carboplatin in most cell lines tested. Remarkably, <b>56-5B3A</b> demonstrated the greatest anticancer activity, displaying GI<sub>50</sub> values between 1.2 and 150 nM. Enhanced production of reactive oxygen species paired with the decline in mitochondrial activity as well as inhibition of histone deacetylase were also demonstrated by the complexes in HT29 colon cells.

Also flagged:chromatinhistonepost-translational modificationsmethylationlysinehistone 3
Journal Article 2024-02-10 No Snippets Seneviratne JA, Ho WWH, Glancy E, Eckersley-Maslin MA.
Show Full Abstract

<h4>Background</h4>Bivalent chromatin is an exemplar of epigenetic plasticity. This co-occurrence of active-associated H3K4me3 and inactive-associated H3K27me3 histone modifications on opposite tails of the same nucleosome occurs predominantly at promoters that are poised for future transcriptional upregulation or terminal silencing. We know little of the dynamics, resolution, and regulation of this chromatin state outside of embryonic stem cells where it was first described. This is partly due to the technical challenges distinguishing bone-fide bivalent chromatin, where both marks are on the same nucleosome, from allelic or sample heterogeneity where there is a mix of H3K4me3-only and H3K27me3-only mononucleosomes.<h4>Results</h4>Here, we present a robust and sensitive method to accurately map bivalent chromatin genome-wide, along with controls, from as little as 2 million cells. We optimized and refined the sequential ChIP protocol which uses two sequential overnight immunoprecipitation reactions to robustly purify nucleosomes that are truly bivalent and contain both H3K4me3 and H3K27me3 modifications. Our method generates high quality genome-wide maps with strong peak enrichment and low background, which can be analyzed using standard bioinformatic packages. Using this method, we detect 8,789 bivalent regions in mouse embryonic stem cells corresponding to 3,918 predominantly CpG rich and developmentally regulated gene promoters. Furthermore, profiling Dppa2/4 knockout mouse embryonic stem cells, which lose both H3K4me3 and H3K27me3 at approximately 10% of bivalent promoters, demonstrated the ability of our method to capture bivalent chromatin dynamics.<h4>Conclusions</h4>Our optimized sequential reChIP method enables high-resolution genome-wide assessment of bivalent chromatin together with all required controls in as little as 2 million cells. We share a detailed protocol and guidelines that will enable bivalent chromatin landscapes to be generated in a range of cellular contexts, greatly enhancing our understanding of bivalent chromatin and epigenetic plasticity beyond embryonic stem cells.

Also flagged:pyelectasischoroid plexus cystsmaternal anxietychromosome22q11.2 deletion syndromechromosomal
Journal Article 2024-02-10 No Snippets Liu Y, Liu S, Liu J, Bai T, Jing X, Deng C, Xia T, Cheng J, Xing L, Wei X, Luo Y, Zhou Q, Xie D, Xiong Y, Liu L, Zhu Q, Liu H.
Show Full Abstract

<h4>Background</h4>Pathogenic (P) copy number variants (CNVs) may be associated with second-trimester ultrasound soft markers (USMs), and noninvasive prenatal screening (NIPS) can enable interrogate the entire fetal genome to screening of fetal CNVs. This study evaluated the clinical application of NIPS for detecting CNVs among fetuses with USMs in pregnant women not of advanced maternal age (AMA).<h4>Results</h4>Fetal aneuploidies and CNVs were identified in 6647 pregnant women using the Berry Genomics NIPS algorithm.Those with positive NIPS results underwent amniocentesis for prenatal diagnosis. The NIPS and prenatal diagnosis results were analyzed and compared among different USMs. A total of 96 pregnancies were scored positive for fetal chromosome anomalies, comprising 37 aneuploidies and 59 CNVs. Positive predictive values (PPVs) for trisomy 21, trisomy 18, trisomy 13, and sex chromosome aneuploidies were 66.67%, 80.00%, 0%, and 30.43%, respectively. NIPS sensitivity for aneuploidies was 100%. For CNVs, the PPVs were calculated as 35.59% and false positive rate of 0.57%. There were six P CNVs, two successfully identified by NIPS and four missed, of which three were below the NIPS resolution limit and one false negative. The incidence of aneuploidies was significantly higher in fetuses with absent or hypoplastic nasal bone, while that of P CNVs was significantly higher in fetuses with aberrant right subclavian artery (ARSA), compared with other groups.<h4>Conclusions</h4>NIPS yielded a moderate PPV for CNVs in non-AMA pregnant women with fetal USM. However, NIPS showed limited ability in identifying P CNVs. Positive NIPS results for CNVs emphasize the need for further prenatal diagnosis. We do not recommend the use of NIPS for CNVs screening in non-AMA pregnant women with fetal USM, especially in fetuses with ARSA.

DCC
Also flagged:PeptideNetrin-1Breast Cancercancertumorextracellular
Journal Article 2024-02-10 ✓ 1 Snippet Moreau C, Lukačević T, Pallier A, Sobilo J, Aci-Sèche S, Garnier N, Même S, Tóth É, Lacerda S.
In-Text Gene Mentions

…its transmembrane receptorDCC.…

Show Full Abstract

Despite significant progress in cancer imaging and treatment over the years, early diagnosis and metastasis detection remain a challenge. Molecular magnetic resonance imaging (MRI), with its high resolution, can be well adapted to fulfill this need, requiring the design of contrast agents which target specific tumor biomarkers. Netrin-1 is an extracellular protein overexpressed in metastatic breast cancer and implicated in tumor progression and the appearance of metastasis. This study focuses on the design and preclinical evaluation of a novel Netrin-1-specific peptide-based MRI probe, GdDOTA-KKTHDAVR (Gd-K), to visualize metastatic breast cancer. The targeting peptide sequence was identified based on the X-ray structure of the complex between Netrin-1 and its transmembrane receptor DCC. Molecular docking simulations support the probe design. <i>In vitro</i> studies evidenced submicromolar affinity of Gd-K for Netrin-1 (<i>K</i><sub>D</sub> = 0.29 μM) and good MRI efficacy (proton relaxivity, <i>r</i><sub>1</sub> = 4.75 mM<sup>-1</sup> s<sup>-1</sup> at 9.4 T, 37 °C). <i>In vivo</i> MRI studies in a murine model of triple-negative metastatic breast cancer revealed successful tumor visualization at earlier stages of tumor development (smaller tumor volume). Excellent signal enhancement, 120% at 2 min and 70% up to 35 min post injection, was achieved (0.2 mmol/kg injected dose), representing a reasonable imaging time window and a superior contrast enhancement in the tumor as compared to Dotarem injection.

HTT
Also flagged:CHCHD2Huntington diseaseHDneurodegenerative diseasepolyglutamineneurodegenerative diseases
Journal Article 2024-02-10 ✓ 5 Snippets Liu X, Wang F, Fan X, Chen M, Xu X, Xu Q, Zhu H, Xu A, Pouladi MA, Xu X.
In-Text Gene Mentions

Although the total HTT mRNA expression appeared similar between the WT and HD cells (Fig. 1B), the total HTT protein levels were decreased in HD cells compared to WT cells (Fig. 1E, F) as shown previously [25].

hiPSCs derived from adult cells of HD patients contain endogenously expressed full-length mutated HTT proteins, making them an ideal model with the same genetic background as the patients.

Huntington disease (HD) is a neurodegenerative disease caused by the abnormal expansion of a polyglutamine tract resulting from a mutation in the HTT gene.

This suggests that the upregulation of CHCHD2 in HD may serve as a compensatory response to mutant HTT, and CHCHD2 could potentially serve as a novel molecular marker of HD pathology.

hiPSCs can be derived from the adult cells of HD patients, carrying endogenously expressed full-length mutated HTT proteins and sharing the exact same genetic background as the patients [39].

Show Full Abstract

Huntington disease (HD) is a neurodegenerative disease caused by the abnormal expansion of a polyglutamine tract resulting from a mutation in the HTT gene. Oxidative stress has been identified as a significant contributing factor to the development of HD and other neurodegenerative diseases, and targeting anti-oxidative stress has emerged as a potential therapeutic approach. CHCHD2 is a mitochondria-related protein involved in regulating cell migration, anti-oxidative stress, and anti-apoptosis. Although CHCHD2 is highly expressed in HD cells, its specific role in the pathogenesis of HD remains uncertain. We postulate that the up-regulation of CHCHD2 in HD models represents a compensatory protective response against mitochondrial dysfunction and oxidative stress associated with HD. To investigate this hypothesis, we employed HD mouse striatal cells and human induced pluripotent stem cells (hiPSCs) as models to examine the effects of CHCHD2 overexpression (CHCHD2-OE) or knockdown (CHCHD2-KD) on the HD phenotype. Our findings demonstrate that CHCHD2 is crucial for maintaining cell survival in both HD mouse striatal cells and hiPSCs-derived neurons. Our study demonstrates that CHCHD2 up-regulation in HD serves as a compensatory protective response against oxidative stress, suggesting a potential anti-oxidative strategy for the treatment of HD.

Also flagged:hydroxyapatitecalciumcopperdegradationwaterapatite
Journal Article 2024-02-10 No Snippets Noori A, Hoseinpour M, Kolivand S, Lotfibakhshaiesh N, Ebrahimi-Barough S, Ai J, Azami M.
Show Full Abstract

Adding foreign ions to hydroxyapatite (HAp) is a popular approach for improving its properties. This study focuses on the effects of calcium substitution with copper in HAp. Instead of calcium, copper ions were doped into the structure of hydroxyapatite nanoparticles at 1%, 3%, and 5% concentrations. XRD analysis showed that the amount of substituted copper was less than needed to generate a distinct phase, yet its lattice parameters and crystallinity slightly decreased. Further, the results of degradation tests revealed that copper doping in hydroxyapatite doubled calcium ion release in water. The incorporation of copper into the apatite structure also boosted the HAp zeta potential and FBS protein adsorption onto powders. According to antibacterial investigations, a concentration of 200 mg/ml of hydroxyapatite containing 5% copper was sufficient to effectively eradicate E. coli and S. aureus bacteria. Furthermore, copper improved hydroxyapatite biocompatibility. Alkaline phosphatase activity and alizarin red tests showed that copper in hydroxyapatite did not inhibit stem cell differentiation into osteoblasts. Also, the scratch test demonstrated that copper-containing hydroxyapatite extract increased HUVEC cell migration. Overall, our findings demonstrated the utility of incorporating copper into the structure of hydroxyapatite from several perspectives, including the induction of antibacterial characteristics, biocompatibility, and angiogenesis.

MMS22L
Also flagged:replication forkresponse to replication stressreplication forksDNA translocasesSMARCAL1ZRANB3
Journal Article 2024-02-10 ✓ 2 Snippets Chen J, Wu M, Yang Y, Ruan C, Luo Y, Song L, Wu T, Huang J, Yang B, Liu T.
In-Text Gene Mentions

…For instance, theMMS22L-TONSL protein complex physica…

…that, unlike theMMS22L-TONSL and BCDX2 complexes,…

Show Full Abstract

Replication fork reversal, a critical protective mechanism against replication stress in higher eukaryotic cells, is orchestrated via a series of coordinated enzymatic reactions. The Bloom syndrome gene product, BLM, a member of the highly conserved RecQ helicase family, is implicated in this process, yet its precise regulation and role remain poorly understood. In this study, we demonstrate that the GCFC domain-containing protein TFIP11 forms a complex with the BLM helicase. TFIP11 exhibits a preference for binding to DNA substrates that mimic the structure generated at stalled replication forks. Loss of either TFIP11 or BLM leads to the accumulation of the other protein at stalled forks. This abnormal accumulation, in turn, impairs RAD51-mediated fork reversal and slowing, sensitizes cells to replication stress-inducing agents, and enhances chromosomal instability. These findings reveal a previously unidentified regulatory mechanism that modulates the activities of BLM and RAD51 at stalled forks, thereby impacting genome integrity.

TNFSF4
Also flagged:cuproptosislung adenocarcinomanon-small-cell lung cancerNSCLCtumorCRG
Journal Article 2024-02-10 ✓ 2 Snippets Tang Y, Wang T, Li Q, Shi J.
In-Text Gene Mentions

Immune checkpoint analysis (Fig. 5B) revealed that basically all the checkpoints were upregulated in the low-risk group except for CD44, TNFSF4/9, and CD276 (marker of cancer stem cell) [33].

…except for CD44,TNFSF4/9, and CD276 (marker…

Show Full Abstract

<h4>Background</h4>Cuproptosis-related genes (CRGs) are associated with lung adenocarcinoma. However, the links between CRGs and non-small-cell lung cancer (NSCLC) are not clear. In this study, we aimed to develop two cuproptosis models and investigate their correlation with NSCLC in terms of clinical features and tumor microenvironment.<h4>Methods</h4>CRG expression profiles and clinical data from NSCLC and normal tissues was obtained from GEO (GSE42127) and TCGA datasets. Molecular clusters were classified into three patterns based on CRGs and cuproptosis cluster-related specific differentially expressed genes (CRDEGs). Then, two clinical models were established. First, a prognostic score model based on CRDEGs was established using univariate/multivariate Cox analysis. Then, through principal component analysis, a cuproptosis score model was established based on prognosis-related genes acquired via univariate analysis of CRDEGs. NSCLC patients were divided into high/low risk groups.<h4>Results</h4>Eighteen CRGs were acquired, all upregulated in tumor tissues, 15 of which significantly (P < 0.05). Among the three CRG clusters, cluster B had the best prognosis. In the CRDEG clusters, cluster C had the best survival. In the prognostic score model, the high-risk group had worse prognosis, higher tumor mutation load, and lower immune infiltration while in the cuproptosis score model, a high score represented better survival, lower tumor mutation load, and high-level immune infiltration.<h4>Conclusions</h4>The cuproptosis score model and prognostic score model may be associated with NSCLC prognosis and immune microenvironment. These novel findings on the progression and immune landscape of NSCLC may facilitate the provision of more personalized immunotherapy interventions for NSCLC patients.

Also flagged:innervationnervecongenital disordersaxonsaxonaldysinnervation disorders
Journal Article 2024-02-10 No Snippets Fritzsch B.
Show Full Abstract

The purpose of this review is to analyze the origin of ocular motor neurons, define the pattern of innervation of nerve fibers that project to the extraocular eye muscles (EOMs), describe congenital disorders that alter the development of ocular motor neurons, and provide an overview of vestibular pathway inputs to ocular motor nuclei. Six eye muscles are innervated by axons of three ocular motor neurons, the oculomotor (CNIII), trochlear (CNIV), and abducens (CNVI) neurons. Ocular motor neurons (CNIII) originate in the midbrain and innervate the ipsilateral orbit, except for the superior rectus and the levator palpebrae, which are contralaterally innervated. Trochlear motor neurons (CNIV) originate at the midbrain-hindbrain junction and innervate the contralateral superior oblique muscle. Abducens motor neurons (CNVI) originate variously in the hindbrain of rhombomeres r4-6 that innervate the posterior (or lateral) rectus muscle and innervate the retractor bulbi. Genes allow a distinction between special somatic (CNIII, IV) and somatic (CNVI) ocular motor neurons. Development of ocular motor neurons and their axonal projections to the EOMs may be derailed by various genetic causes, resulting in the congenital cranial dysinnervation disorders. The ocular motor neurons innervate EOMs while the vestibular nuclei connect with the midbrain-brainstem motor neurons.

HFE
Also flagged:Ferritiniron deficiencyIDoxygenIronmineral
Journal Article 2024-02-10 ✓ 1 Snippet Lemaire B, Frias MA, Golaz O, Magnin JL, Viette V, Vuilleumier N, Waldvogel Abramowski S.
In-Text Gene Mentions

…used to managehemochromatosis.…

Show Full Abstract

<h4>Objectives</h4>To determine the ferritin inter-assay differences between three "Conformité Européenne" (CE) marked tests, the impact on reference intervals (RI), and the proportion of individuals with iron deficiency (ID), we used plasma and serum from healthy blood donors (HBD) recruited in three different Switzerland regions.<h4>Design and methods</h4>Heparinized plasma and serum from HBD were obtained from three different transfusion centers in Switzerland (Fribourg, Geneva, and Neuchatel). One hundred forty samples were recruited per center and per matrix, with a gender ratio of 50%, for a total of 420 HBD samples available per matrix. On both matrices, ferritin concentrations were quantified by three different laboratories using electrochemiluminescence (ECL), latex immunoturbidimetric assay (LIA), and luminescent oxygen channeling immunoassay (LOCI) assays, respectively. The degree of agreement between matrices and between the three sites/methods was assessed by Passing-Bablok and we evaluated the proportion of individuals deemed to have ID per method.<h4>Results</h4>Overall, no difference between serum and heparinized plasma ferritin values was observed according to Passing-Bablok analyses (proportional bias range: 1.0-3.0%; maximum constant bias: 1.84 µg/L). Significant median ferritin differences (<i>p</i> < 0.001 according to Kruskal-Wallis test) were observed between the three methods (i.e., 83.6 µg/L, 103.5 µg/L, and 62.1 µg/L for ECL, LIA, and LOCI in heparinized plasma, respectively), with proportional bias varying significantly between ±16% and ±32% on serum and from ±14% to ±35% on plasma with no sign of gender-related differences. Affecting the lower end of RI, the proportion of ID per method substantially varied between 4.76% (20/420) for ECL, 2.86% (12/420) for LIA, and 9.05% (38/420) for LOCI.<h4>Conclusions</h4>Serum and heparinized plasma are exchangeable for ferritin assessment. However, the order of magnitude of ferritin differences across methods and HBD recruitment sites could lead to diagnostic errors if uniform RI were considered. Challenging the recently proposed use of uniform ferritin thresholds, our results highlight the importance of method- and region-specific RI for ferritin due to insufficient inter-assay harmonization. Failing to do so significantly impacts ID diagnosis.

Also flagged:OrganicSynthesisCFTRCystic FibrosisCFanion channel
Journal Article 2024-02-10 No Snippets Ferreira FC, Buarque CD, Lopes-Pacheco M.
Show Full Abstract

The monogenic rare disease Cystic Fibrosis (CF) is caused by mutations in the gene encoding the CF transmembrane conductance (CFTR) protein, an anion channel expressed at the apical plasma membrane of epithelial cells. The discovery and subsequent development of CFTR modulators-small molecules acting on the basic molecular defect in CF-have revolutionized the standard of care for people with CF (PwCF), thus drastically improving their clinical features, prognosis, and quality of life. Currently, four of these drugs are approved for clinical use: potentiator ivacaftor (VX-770) alone or in combination with correctors lumacaftor, (VX-809), tezacaftor (VX-661), and elexacaftor (VX-445). Noteworthily, the triple combinatorial therapy composed of ivacaftor, tezacaftor, and elexacaftor constitutes the most effective modulator therapy nowadays for the majority of PwCF. In this review, we exploit the organic synthesis of ivacaftor, tezacaftor, and elexacaftor by providing a retrosynthetic drug analysis for these CFTR modulators. Furthermore, we describe the current understanding of the mechanisms of action (MoA's) of these compounds by discussing several studies that report the key findings on the molecular mechanisms underlying their action on the CFTR protein.

SERPINC1
Also flagged:diabetic macular edemadiabetescomplement activationextracellularcholesterolmetabolism
Journal Article 2024-02-10 ✓ 2 Snippets Cehofski LJ, Kojima K, Kusada N, Hansen MS, Muttuvelu DV, Bakker N, Klaassen I, Grauslund J, Vorum H, Honoré B.
In-Text Gene Mentions

…lpha-1-antitrypsin (SERPINA1),antithrombin-III(SERPINC1), heparin cofactor…

…(SERPINA1), antithrombin-III (SERPINC1), heparin cofactor 2…

Show Full Abstract

<h4>Purpose</h4>Diabetic macular edema (DME) is a sight-threatening complication of diabetes. Consequently, studying the proteome of DME may provide novel insights into underlying molecular mechanisms.<h4>Methods</h4>In this study, aqueous humor samples from eyes with treatment-naïve clinically significant DME (n = 13) and age-matched controls (n = 11) were compared with label-free liquid chromatography-tandem mass spectrometry. Additional aqueous humor samples from eyes with treatment-naïve DME (n = 15) and controls (n = 8) were obtained for validation by enzyme-linked immunosorbent assay (ELISA). Best-corrected visual acuity (BCVA) was evaluated, and the severity of DME was measured as central subfield thickness (CST) employing optical coherence tomography. Control samples were obtained before cataract surgery. Significantly changed proteins were identified using a permutation-based calculation, with a false discovery rate of 0.05. A human donor eye with DME and a control eye were used for immunofluorescence.<h4>Results</h4>A total of 101 proteins were differentially expressed in the DME. Regulated proteins were involved in complement activation, glycolysis, extracellular matrix interaction, and cholesterol metabolism. The highest-fold change was observed for the fibrinogen alpha chain (fold change = 17.8). Complement components C2, C5, and C8, fibronectin, and hepatocyte growth factor-like protein were increased in DME and correlated with best-corrected visual acuity (BCVA). Ceruloplasmin and complement component C8 correlated with central subfield thickness (CST). Hemopexin, plasma kallikrein, monocyte differentiation antigen CD14 (CD14), and lipopolysaccharide-binding protein (LBP) were upregulated in the DME. LBP was correlated with vascular endothelial growth factor. The increased level of LBP in DME was confirmed using ELISA. The proteins involved in desmosomal integrity, including desmocollin-1 and desmoglein-1, were downregulated in DME and correlated negatively with CST. Immunofluorescence confirmed the extravasation of fibrinogen at the retinal level in the DME.<h4>Conclusion</h4>Elevated levels of pro-inflammatory proteins, including the complement components LBP and CD14, were observed in DME. DME was associated with the loss of basal membrane proteins, compromised desmosomal integrity, and perturbation of glycolysis.

SOX6
Also flagged:CisplatinCircularoral squamous cell carcinomaOSCCtumorpolylysine
Journal Article 2024-02-10 ✓ 5 Snippets Fan HY, Zhao MD, Jiang HJ, Yu ZW, Fan YJ, Liang XH, Tang YL, Sun Y.
In-Text Gene Mentions

The circCPNE1/miR-330-3p pathway is involved in regulating OSCC processes and affects the expression of SOX6

Multiple studies have reported that SOX6 acts as a typical tumor suppressor in various cancers, such as esophageal squamous carcinoma42, pancreatic cancer43, and prostate cancer.44

In addition, we found that SOX6 expression was significantly higher in the circCPNE1 OE group than the control group in the subcutaneous tumors of nude mice (Fig. 3K and L, and Supporting Information Fig. S8), which further indicates that SOX6 is a downstream target of the circCPNE1/miR-330-3p axis.

In this study, we determined that the circCPNE1 level was associated with the clinical stage of OSCC; we then validated the ability of the circCPNE1/miR-330-3p pathway to suppress OSCC tumors and regulate the expression levels of the SOX6, AKT, and Bcl-2 proteins.

In conclusion, we found that the circCPNE1/miR-330-3p/SOX6 signaling pathway may be involved in regulating OSCC development (Fig. 3M).

Show Full Abstract

Circular RNAs (circRNAs) are ideal biomarkers of oral squamous cell carcinoma (OSCC) because of their highly stable closed-loop structure, and they can act as microRNA (miRNA) sponges to regulate OSCC progression. By analyzing clinical samples, we identified circCPNE1, a dysregulated circRNA in OSCC, and its expression level was negatively correlated with the clinical stage of OSCC patients. Gain-of-function assays revealed the tumor-suppressive effect of circCPNE1, which was then identified as a miR-330-3p sponge. MiR-330-3p was recognized as a tumor promoter in multiple studies, consistent with our finding that it could promote the proliferation, migration, and invasion of OSCC cells. These results indicated that selective inhibition of miR-330-3p could be an effective strategy to inhibit OSCC progression. Therefore, we designed cationic polylysine-cisplatin prodrugs to deliver antagomiR-330-3p (a miRNA inhibitory analog) <i>via</i> electrostatic interactions to form PP@miR nanoparticles (NPs). Paratumoral administration results revealed that PP@miR NPs effectively inhibited subcutaneous tumor progression and achieved partial tumor elimination (2/5), which confirmed the critical role of miR-330-3p in OSCC development. These findings provide a new perspective for the development of OSCC treatments.

bioRxiv 2024-02-10 Preprint (No Snippets API) Rani R, Sri NS, Medishetti R, Chatti K, Sevilimedu A.
Show Full Abstract

Fragile X syndrome (FXS) is an inherited neurodevelopmental disorder and the leading genetic cause of autism spectrum disorders. FXS is caused by loss of function mutations in Fragile X mental retardation protein (FMRP), an RNA binding protein that is known to regulate translation of its target mRNAs, predominantly in the brain and gonads. The molecular mechanisms connecting FMRP function to neurodevelopmental phenotypes are well understood. However, neither the full extent of reproductive phenotypes, nor the underlying molecular mechanisms have been as yet determined. Here, we developed new fmr1 knockout zebrafish lines and show that they mimic key aspects of FXS neuronal phenotypes across both larval and adult stages. Results from the fmr1 knockout females also showed that altered gene expression in the brain, via the neuroendocrine pathway contribute to distinct abnormal phenotypes during ovarian development and oocyte maturation. We identified at least three mechanisms underpinning these defects, including altered neuroendocrine signaling in sexually mature females resulting in accelerated ovarian development, altered expression of germ cell and meiosis promoting genes at various stages during oocyte maturation, and finally a strong mitochondrial impairment in late stage oocytes from knockout females. Our findings have implications beyond FXS in the study of reproductive function and female infertility. Dissection of the translation control pathways during ovarian development using models like the knockout lines reported here may reveal novel approaches and targets for fertility treatments. <h4>Abstract Figure</h4> Graphical Abstract

SOX6
Also flagged:tumorssex-determining regiontranscription factorsSOXtumorepithelial-mesenchymal transition
Journal Article 2024-02-09 ✓ 5 Snippets Jiang J, Wang Y, Sun M, Luo X, Zhang Z, Wang Y, Li S, Hu D, Zhang J, Wu Z, Chen X, Zhang B, Xu X, Wang S, Xu S, Huang W, Xia L.
In-Text Gene Mentions

In HCC, SOX6 inhibits NPM1 via repressing c-MYC, which subsequently stabilizes and activates p53 via promoting the formation of the p14ARF/HDM2/p53 complex, ultimately inhibiting HCC proliferation [126].

Ueda et al. synthesized a SOX6 peptide that induces specific cytotoxic T lymphocytes capable of lysing GSCs derived from GBM [183].

In primary human GBM cells, SOX5, SOX6, and SOX21 induce apoptosis by upregulating CDK inhibitors and downregulating p53 protein turnover [127].

Even with normal expression of SOX9, knocking out SOX5 and SOX6 simultaneously can lead to mouse death in the uterus due to chondrodysplasia [38].

…subgroup D (SOX5,SOX6, SOX13), subgroup E…

Show Full Abstract

The sex-determining region Y (SRY)-related high-mobility group (HMG) box (SOX) family, composed of 20 transcription factors, is a conserved family with a highly homologous HMG domain. Due to their crucial role in determining cell fate, the dysregulation of SOX family members is closely associated with tumorigenesis, including tumor invasion, metastasis, proliferation, apoptosis, epithelial-mesenchymal transition, stemness and drug resistance. Despite considerable research to investigate the mechanisms and functions of the SOX family, confusion remains regarding aspects such as the role of the SOX family in tumor immune microenvironment (TIME) and contradictory impacts the SOX family exerts on tumors. This review summarizes the physiological function of the SOX family and their multiple roles in tumors, with a focus on the relationship between the SOX family and TIME, aiming to propose their potential role in cancer and promising methods for treatment.

CACNA1E
Also flagged:Major depressive disorderAnhedoniasleepdepressionseasonal depressionpathogenesis
Journal Article 2024-02-09 ✓ 1 Snippet Cui L, Li S, Wang S, Wu X, Liu Y, Yu W, Wang Y, Tang Y, Xia M, Li B.
In-Text Gene Mentions

Although the etiology of MDD is still unclear, numerous studies have been performed and various models have been employed to explore the genetic factors, environmental factors and gene-environment interactions related to the disease.24 Recent family, twin, and adoption studies suggests that genetic factors play a crucial role in the occurrence of MDD.25 As a genetically diverse illness, MDD has a heritability of 30–50%.26 Over 100 gene loci, including those associated with presynaptic vesicle trafficking (PCLO), dopaminergic neurotransmission (a primary target of antipsychotics), glutamate ionotropic receptor kainate type subunit 5 (GRIK5), and metabotropic glutamate receptor 5 (GRM5), and neuronal calcium signaling such as calcium voltage-gated channel subunit alpha1 E (CACNA1E) and calcium voltage-gated channel auxiliary subunit alpha2 delta1 (CACNA2D1), are found to be associated with an increased risk of MDD by genome-wide association studies.19,27,28 In addition, rare copy number variants are also identified to be related to MDD risk, there may be three copy number variants (CNV) loci associated with Prader-Willis syndrome: 1q21.1 duplication, 15q11-13, and 16p11.2.

Show Full Abstract

Worldwide, the incidence of major depressive disorder (MDD) is increasing annually, resulting in greater economic and social burdens. Moreover, the pathological mechanisms of MDD and the mechanisms underlying the effects of pharmacological treatments for MDD are complex and unclear, and additional diagnostic and therapeutic strategies for MDD still are needed. The currently widely accepted theories of MDD pathogenesis include the neurotransmitter and receptor hypothesis, hypothalamic-pituitary-adrenal (HPA) axis hypothesis, cytokine hypothesis, neuroplasticity hypothesis and systemic influence hypothesis, but these hypothesis cannot completely explain the pathological mechanism of MDD. Even it is still hard to adopt only one hypothesis to completely reveal the pathogenesis of MDD, thus in recent years, great progress has been made in elucidating the roles of multiple organ interactions in the pathogenesis MDD and identifying novel therapeutic approaches and multitarget modulatory strategies, further revealing the disease features of MDD. Furthermore, some newly discovered potential pharmacological targets and newly studied antidepressants have attracted widespread attention, some reagents have even been approved for clinical treatment and some novel therapeutic methods such as phototherapy and acupuncture have been discovered to have effective improvement for the depressive symptoms. In this work, we comprehensively summarize the latest research on the pathogenesis and diagnosis of MDD, preventive approaches and therapeutic medicines, as well as the related clinical trials.

Also flagged:myoclonusepilepsymovement disorderepileptic syndromesbenign infantile myoclonusencephalopathy
Journal Article 2024-02-09 No Snippets Riva A, D'Onofrio G, Ferlazzo E, Pascarella A, Pasini E, Franceschetti S, Panzica F, Canafoglia L, Vignoli A, Coppola A, Badioni V, Beccaria F, Labate A, Gambardella A, Romeo A, Capovilla G, Michelucci R, Striano P, Belcastro V.
Show Full Abstract

Myoclonus classically presents as a brief (10-50 ms duration), non-rhythmic jerk movement. The etiology could vary considerably ranging from self-limited to chronic or even progressive disorders, the latter falling into encephalopathic pictures that need a prompt diagnosis. Beyond the etiological classification, others evaluate myoclonus' body distribution (i.e., clinical classification) or the location of the generator (i.e., neurophysiological classification); particularly, knowing the anatomical source of myoclonus gives inputs on the observable clinical patterns, such as EMG bursts duration or EEG correlate, and guides the therapeutic choices. Among all the chronic disorders, myoclonus often presents itself as a manifestation of epilepsy. In this context, myoclonus has many facets. Myoclonus occurs as one, or the only, seizure manifestation while it can also present as a peculiar type of movement disorder; moreover, its electroclinical features within specific genetically determined epileptic syndromes have seldom been investigated. In this review, following a meeting of recognized experts, we provide an up-to-date overview of the neurophysiology and nosology surrounding myoclonus. Through the dedicated exploration of epileptic syndromes, coupled with pragmatic guidance, we aim to furnish clinicians and researchers alike with practical advice for heightened diagnostic management and refined treatment strategies. PLAIN LANGUAGE SUMMARY: In this work, we described myoclonus, a movement characterized by brief, shock-like jerks. Myoclonus could be present in different diseases and its correct diagnosis helps treatment.

CACNA1E
Also flagged:tinnitushearinglosshyperacusisTNFRSF1AANK2
Journal Article 2024-02-09 ✓ 3 Snippets Perez-Carpena P, Lopez-Escamez JA, Gallego-Martinez Á.
In-Text Gene Mentions

The identification of genes such as CACNA1E or NAV2, showing enrichment of missense and large structural variants in patients with tinnitus may lead to defining new druggable targets for tinnitus.

…1) activity; theCACNA1E(calcium voltage-gated channel…

…genes such asCACNA1Eor NAV2 ,…

Show Full Abstract

<h4>Purpose</h4>To assess the available evidence to support a genetic contribution and define the role of common and rare variants in tinnitus.<h4>Methods</h4>After a systematic search and quality assessment, 31 records including 383,063 patients were selected (14 epidemiological studies and 17 genetic association studies). General information on the sample size, age, sex, tinnitus prevalence, severe tinnitus distribution, and sensorineural hearing loss was retrieved. Studies that did not include data on hearing assessment were excluded. Relative frequencies were used for qualitative variables to compare different studies and to obtain average values. Genetic variants and genes were listed and clustered according to their potential role in tinnitus development.<h4>Results</h4>The average prevalence of tinnitus estimated from population-based studies was 26.3% for any tinnitus, and 20% of patients with tinnitus reported it as an annoying symptom. One study has reported population-specific differences in the prevalence of tinnitus, the white ancestry being the population with a higher prevalence. Genome-wide association studies have identified and replicated two common variants in the Chinese population (rs2846071; rs4149577) in the intron of TNFRSF1A, associated with noise-induced tinnitus. Moreover, gene burden analyses in sequencing data from Spanish and Swede patients with severe tinnitus have identified and replicated ANK2, AKAP9, and TSC2 genes.<h4>Conclusions</h4>The genetic contribution to tinnitus is starting to be revealed and it shows population-specific effects in European and Asian populations. The common allelic variants associated with tinnitus that showed replication are associated with noise-induced tinnitus. Although severe tinnitus has been associated with rare variants with large effect, their role on hearing or hyperacusis has not been established.

SUDS3
Also flagged:innate immunityMitochondriaorganellemitochondrialtranscription factorchromatin
Journal Article 2024-02-09 ✓ 1 Snippet Kim S, Ramalho TR, Haynes CM.
In-Text Gene Mentions

…which induces thehistone deacetylase complexdeacetylase complex (NuRD)…

Show Full Abstract

Mitochondria are perhaps best known as the "powerhouse of the cell" for their role in ATP production required for numerous cellular activities. Mitochondria have emerged as an important signaling organelle. Here, we first focus on signaling pathways mediated by mitochondria-nuclear communication that promote protein homeostasis (proteostasis). We examine the mitochondrial unfolded protein response (UPRmt) in C. elegans, which is regulated by a transcription factor harboring both a mitochondrial- and nuclear-targeting sequence, the integrated stress response in mammals, as well as the regulation of chromatin by mitochondrial metabolites. In the second section, we explore the role of mitochondria-to-nuclear communication in the regulation of innate immunity and inflammation. Perhaps related to their prokaryotic origin, mitochondria harbor molecules also found in viruses and bacteria. If these molecules accumulate in the cytosol, they elicit the same innate immune responses as viral or bacterial infection.

OLFM4
Also flagged:methylationdevelopmental disordersgene expressionCDCA7cell division cycle associated 7immunodeficiency
Journal Article 2024-02-09 ✓ 1 Snippet Vukic M, Chouaref J, Della Chiara V, Dogan S, Ratner F, Hogenboom JZM, Epp TA, Chawengsaksophak K, Vonk KKD, Breukel C, Ariyurek Y, San Leon Granado D, Kloet SL, Daxinger L.
In-Text Gene Mentions

…olfactomedin 4 (Olfm4), a member…

Show Full Abstract

Disruption of cell division cycle associated 7 (CDCA7) has been linked to aberrant DNA hypomethylation, but the impact of DNA methylation loss on transcription has not been investigated. Here, we show that CDCA7 is critical for maintaining global DNA methylation levels across multiple tissues in vivo. A pathogenic <i>Cdca7</i> missense variant leads to the formation of large, aberrantly hypomethylated domains overlapping with the B genomic compartment but without affecting the deposition of H3K9 trimethylation (H3K9me3). CDCA7-associated aberrant DNA hypomethylation translated to localized, tissue-specific transcriptional dysregulation that affected large gene clusters. In the brain, we identify CDCA7 as a transcriptional repressor and epigenetic regulator of clustered <i>protocadherin</i> isoform choice. Increased <i>protocadherin</i> isoform expression frequency is accompanied by DNA methylation loss, gain of H3K4 trimethylation (H3K4me3), and increased binding of the transcriptional regulator CCCTC-binding factor (CTCF). Overall, our in vivo work identifies a key role for CDCA7 in safeguarding tissue-specific expression of gene clusters via the DNA methylation pathway.

Also flagged:localizationlung cancerNSCLCcanceractin regulatory proteintumor
Journal Article 2024-02-09 No Snippets Di Modugno F, Di Carlo A, Spada S, Palermo B, D'Ambrosio L, D'Andrea D, Morello G, Belmonte B, Sperduti I, Balzano V, Gallo E, Melchionna R, Panetta M, Campo G, De Nicola F, Goeman F, Antoniani B, Carpano S, Frigè G, Warren S, Gallina F, Lambrechts D, Xiong J, Vincent BG, Wheeler N, Bortone DS, Cappuzzo F, Facciolo F, Tripodo C, Visca P, Nisticò P.
Show Full Abstract

<h4>Background</h4>Tertiary Lymphoid Structures (TLS) correlate with positive outcomes in patients with NSCLC and the efficacy of immune checkpoint blockade (ICB) in cancer. The actin regulatory protein hMENA undergoes tissue-specific splicing, producing the epithelial hMENA<sup>11a</sup> linked to favorable prognosis in early NSCLC, and the mesenchymal hMENAΔv6 found in invasive cancer cells and pro-tumoral cancer-associated fibroblasts (CAFs). This study investigates how hMENA isoforms in tumor cells and CAFs relate to TLS presence, localization and impact on patient outcomes and ICB response.<h4>Methods</h4>Methods involved RNA-SEQ on NSCLC cells with depleted hMENA isoforms. A retrospective observational study assessed tissues from surgically treated N0 patients with NSCLC, using immunohistochemistry for tumoral and stromal hMENA isoforms, fibronectin, and TLS presence. ICB-treated patient tumors were analyzed using Nanostring nCounter and GeoMx spatial transcriptomics. Multiparametric flow cytometry characterized B cells and tissue-resident memory T cells (T<sub>RM</sub>). Survival and ICB response were estimated in the cohort and validated using bioinformatics pipelines in different datasets.<h4>Findings</h4>Findings indicate that hMENA<sup>11a</sup> in NSCLC cells upregulates the TLS regulator LTβR, decreases fibronectin, and favors CXCL13 production by T<sub>RM</sub>. Conversely, hMENAΔv6 in CAFs inhibits LTβR-related NF-kB pathway, reduces CXCL13 secretion, and promotes fibronectin production. These patterns are validated in N0 NSCLC tumors, where hMENA11a<sup>high</sup> expression, CAF hMENAΔv6<sup>low</sup>, and stromal fibronectin<sup>low</sup> are associated with intratumoral TLS, linked to memory B cells and predictive of longer survival. The hMENA isoform pattern, fibronectin, and LTβR expression broadly predict ICB response in tumors where TLS indicates an anti-tumor immune response.<h4>Interpretation</h4>This study uncovers hMENA alternative splicing as an unexplored contributor to TLS-related Tumor Immune Microenvironment (TIME) and a promising biomarker for clinical outcomes and likely ICB responsiveness in N0 patients with NSCLC.<h4>Funding</h4>This work is supported by AIRC (IG 19822), ACC (RCR-2019-23669120), CAL.HUB.RIA Ministero Salute PNRR-POS T4, "Ricerca Corrente" granted by the Italian Ministry of Health.

Also flagged:mitochondriamitochondrialmitophagydegradationlocalizationeukaryotic initiation factor 2
Journal Article 2024-02-09 No Snippets Chakrabarty Y, Yang Z, Chen H, Chan DC.
Show Full Abstract

To maintain mitochondrial homeostasis, damaged or excessive mitochondria are culled in coordination with the physiological state of the cell. The integrated stress response (ISR) is a signaling network that recognizes diverse cellular stresses, including mitochondrial dysfunction. Because the four ISR branches converge to common outputs, it is unclear whether mitochondrial stress detected by this network can regulate mitophagy, the autophagic degradation of mitochondria. Using a whole-genome screen, we show that the heme-regulated inhibitor (HRI) branch of the ISR selectively induces mitophagy. Activation of the HRI branch results in mitochondrial localization of phosphorylated eukaryotic initiation factor 2, which we show is sufficient to induce mitophagy. The HRI mitophagy pathway operates in parallel with the mitophagy pathway controlled by the Parkinson's disease related genes PINK1 and PARKIN and is mechanistically distinct. Therefore, HRI repurposes machinery that is normally used for translational initiation to trigger mitophagy in response to mitochondrial damage.

Also flagged:neurodegenerative diseasessynthesisacetamideMAO-AMAO-Bcholinesterases
Journal Article 2024-02-09 No Snippets Camargo-Ayala L, Bedoya M, Prent-Peñaloza L, Polo-Cuadrado E, Osorio E, Brito I, Delgado GE, González W, Gutierrez M.
Show Full Abstract

The increase in and concern about neurodegenerative diseases continue to grow in an increasingly long-lived world population. Therefore, the search for new drugs continues to be a priority for medicinal chemistry. We present here the synthesis of a series of compounds with acetamide nuclei. Their structures were established using UV-Visible, NMR, HRMS and IR techniques. Furthermore, we report the crystal structures that were obtained from compounds 5a-5d by X-ray diffraction. The compounds were evaluated as potential inhibitors of the monoxidase enzymes; A (MAO-A) and B (MAO-B), and cholinesterases; acetylcholinesterase (AChE) and butyrylcholinesterase (BChE) through <i>in silico</i> studies using the induced fit docking (IFD) method and binding free energy (Δ<i>G</i><sub>bind</sub>) calculations by the MMGBSA method. Interestingly, compounds 5b, 5c and 5d showed much better Δ<i>G</i><sub>bind</sub> than the reference drug Zonisamide. Compound 5c is the best in the series, which indicates a potential selective affinity of our compounds against MAO-B, which could be a promising finding in the search for new drugs for Parkinson's disease treatment. The acetamide crystal exhibits moderate NLO properties suggesting that it could be considered a potential candidate for application in nonlinear optical devices.

FBXL4
Also flagged:Drp1mitochondrialpathogenesisobesityhypertensionmitochondrial fission protein
Journal Article 2024-02-09 ✓ 5 Snippets Abudureyimu M, Luo X, Jiang L, Jin X, Pan C, Yu W, Ge J, Zhang Y, Ren J.
In-Text Gene Mentions

FBXL4 failed to affect ‘two-hit’ challenge-induced responses in blood pressure, glucose intolerance, plasma insulin and heart rate although it overtly attenuated ‘two-hit’ challenge-evoked exercise intolerance, cardiac hypertrophy, and pulmonary edema.

Cells were transduced with adenoviruses carrying LacZ and FBXL4 (Ad-FBXL4) at the indicated multiplicity of infection (MOI) for 48 h.

FBXL4 participates in phosphorylation-directed ubiquitination [19], and plays a crucial role in the maintenance of mtDNA as missense and recessive nonsense mutations of FBXL4 prompt to pathological changes such as lactic acidemia, congenital hypotonia, and mitochondrial encephalomyopathy [20].

Cells were transduced with adenoviruses carrying LacZ and FBXL4 (Adv-FBXL4) at the indicated multiplicity of infection (MOI) for 48 h as per the manufacturer's instruction.

Our study revealed that FBXL4 rescued against HFpEF-induced cardiac remodeling, pulmonary edema, diastolic dysfunction, exercise intolerance, and mitochondrial injury, with little impact on blood pressure, plasma insulin level and glucose intolerance in HFpEF mice.

Show Full Abstract

<h4>Aims</h4>Heart failure with preserved ejection fraction (HFpEF) is a devastating health issue although limited knowledge is available for its pathogenesis and therapeutics. Given the perceived involvement of mitochondrial dysfunction in HFpEF, this study was designed to examine the role of mitochondrial dynamics in the etiology of HFpEF.<h4>Method and results</h4>Adult mice were placed on a high fat diet plus l-NAME in drinking water ('two-hit' challenge to mimic obesity and hypertension) for 15 consecutive weeks. Mass spectrometry revealed pronounced changes in mitochondrial fission protein Drp1 and E3 ligase FBXL4 in 'two-hit' mouse hearts. Transfection of FBXL4 rescued against HFpEF-compromised diastolic function, cardiac geometry, and mitochondrial integrity without affecting systolic performance, in conjunction with altered mitochondrial dynamics and integrity (hyperactivation of Drp1 and unchecked fission). Mass spectrometry and co-IP analyses unveiled an interaction between FBXL4 and Drp1 to foster ubiquitination and degradation of Drp1. Truncated mutants of FBXL4 (Delta-Fbox) disengaged interaction between FBXL4 and Drp1. Metabolomic and proteomics findings identified deranged fatty acid and glucose metabolism in HFpEF patients and mice. A cellular model was established with concurrent exposure of high glucose and palmitic acid as a 'double-damage' insult to mimic diastolic anomalies in HFpEF. Transfection of FBXL4 mitigated 'double-damage'-induced cardiomyocyte diastolic dysfunction and mitochondrial injury, the effects were abolished and mimicked by Drp1 knock-in and knock-out, respectively. HFpEF downregulated sarco(endo)plasmic reticulum (SR) Ca<sup>2+</sup> uptake protein SERCA2a while upregulating phospholamban, RYR1, IP3R1, IP3R3 and Na<sup>+</sup>-Ca<sup>2+</sup> exchanger with unaltered SR Ca<sup>2+</sup> load. FBXL4 ablated 'two-hit' or 'double-damage'-induced changes in SERCA2a, phospholamban and mitochondrial injury.<h4>Conclusion</h4>FBXL4 rescued against HFpEF-induced cardiac remodeling, diastolic dysfunction, and mitochondrial injury through reverting hyperactivation of Drp1-mediated mitochondrial fission, underscoring the therapeutic promises of FBXL4 in HFpEF.

Also flagged:Ovarian cancerOCcancerdeathhigh-grade-serous ovarian carcinomatumour
Journal Article 2024-02-09 No Snippets Monjé N, Dragomir MP, Sinn BV, Hoffmann I, Makhmut A, Simon T, Kunze CA, Ihlow J, Schmitt WD, Pohl J, Piwonski I, Marchenko S, Keunecke C, Calina TG, Tiso F, Kulbe H, Kreuzinger C, Cacsire Castillo-Tong D, Sehouli J, Braicu EI, Denkert C, Darb-Esfahani S, Kübler K, Capper D, Coscia F, Morkel M, Horst D, Sers C, Taube ET.
Show Full Abstract

<h4>Background</h4>The aim of this study was to analyse transcriptomic differences between primary and recurrent high-grade serous ovarian carcinoma (HGSOC) to identify prognostic biomarkers.<h4>Methods</h4>We analysed 19 paired primary and recurrent HGSOC samples using targeted RNA sequencing. We selected the best candidates using in silico survival and pathway analysis and validated the biomarkers using immunohistochemistry on a cohort of 44 paired samples, an additional cohort of 504 primary HGSOCs and explored their function.<h4>Results</h4>We identified 233 differential expressed genes. Twenty-three showed a significant prognostic value for PFS and OS in silico. Seven markers (AHRR, COL5A2, FABP4, HMGCS2, ITGA5, SFRP2 and WNT9B) were chosen for validation at the protein level. AHRR expression was higher in primary tumours (p < 0.0001) and correlated with better patient survival (p < 0.05). Stromal SFRP2 expression was higher in recurrent samples (p = 0.009) and protein expression in primary tumours was associated with worse patient survival (p = 0.022). In multivariate analysis, tumour AHRR and SFRP2 remained independent prognostic markers. In vitro studies supported the anti-tumorigenic role of AHRR and the oncogenic function of SFRP2.<h4>Conclusions</h4>Our results underline the relevance of AHRR and SFRP2 proteins in aryl-hydrocarbon receptor and Wnt-signalling, respectively, and might lead to establishing them as biomarkers in HGSOC.

Also flagged:Histoneaginggene expressionchromatinhistonesnucleosome
Journal Article 2024-02-09 No Snippets Dubey SK, Dubey R, Kleinman ME.
Show Full Abstract

As the global population experiences a notable surge in aging demographics, the need to understand the intricate molecular pathways exacerbated by age-related stresses, including epigenetic dysregulation, becomes a priority. Epigenetic mechanisms play a critical role in driving age-related diseases through altered gene expression, genomic instability, and irregular chromatin remodeling. In this review, we focus on histones, a central component of the epigenome, and consolidate the key findings of histone loss and genome-wide redistribution as fundamental processes contributing to aging and senescence. The review provides insights into novel histone expression profiles, nucleosome occupancy, disruptions in higher-order chromatin architecture, and the emergence of noncanonical histone variants in the aging cellular landscape. Furthermore, we explore the current state of our understanding of the molecular mechanisms of histone deficiency in aging cells. Specific emphasis is placed on highlighting histone degradation pathways in the cell and studies that have explored potential strategies to mitigate histone loss or restore histone levels in aging cells. Finally, in addressing future perspectives, the insights gained from this review hold profound implications for advancing strategies that actively intervene in modulating histone expression profiles in the context of cellular aging and identifying potential therapeutic targets for alleviating a multitude of age-related diseases.

Also flagged:atherosclerosishydroxyapatitecalciumvascular calcificationagingdiabetes
Journal Article 2024-02-09 No Snippets Villa-Bellosta R.
Show Full Abstract

The primary cause of worldwide mortality and morbidity stems from complications in the cardiovascular system resulting from accelerated atherosclerosis and arterial stiffening. Frequently, both pathologies are associated with the pathological calcification of cardiovascular structures, present in areas such as cardiac valves or blood vessels (vascular calcification). The accumulation of hydroxyapatite, the predominant form of calcium phosphate crystals, is a distinctive feature of vascular calcification. This phenomenon is commonly observed as a result of aging and is also linked to various diseases such as diabetes, chronic kidney disease, and several genetic disorders. A substantial body of evidence indicates that vascular calcification involves two primary processes: a passive process and an active process. The physicochemical process of hydroxyapatite formation and deposition (a passive process) is influenced significantly by hyperphosphatemia. However, the active synthesis of calcification inhibitors, including proteins and low-molecular-weight inhibitors such as pyrophosphate, is crucial. Excessive calcification occurs when there is a loss of function in enzymes and transporters responsible for extracellular pyrophosphate metabolism. Current in vivo treatments to prevent calcification involve addressing hyperphosphatemia with phosphate binders and implementing strategies to enhance the availability of pyrophosphate.

DNAH10
Also flagged:SchizophreniaMicrotubuleActinpsychiatric disorderCytoskeletonCoro1c
Journal Article 2024-02-09 ✓ 1 Snippet Loe-Mie Y, Plançon C, Dubertret C, Yoshikawa T, Yalcin B, Collins SC, Boland A, Deleuze JF, Gorwood P, Benmessaoud D, Simonneau M, Lepagnol-Bestel AM.
In-Text Gene Mentions

…SECIPBP2, DNAH6, andDNAH10( Figure 4…

Show Full Abstract

Schizophrenia (SZ) is a heterogeneous and debilitating psychiatric disorder with a strong genetic component. To elucidate functional networks perturbed in schizophrenia, we analysed a large dataset of whole-genome studies that identified SNVs, CNVs, and a multi-stage schizophrenia genome-wide association study. Our analysis identified three subclusters that are interrelated and with small overlaps: GO:0007017~Microtubule-Based Process, GO:00015629~Actin Cytoskeleton, and GO:0007268~SynapticTransmission. We next analysed three distinct trio cohorts of 75 SZ Algerian, 45 SZ French, and 61 SZ Japanese patients. We performed Illumina HiSeq whole-exome sequencing and identified de novo mutations using a Bayesian approach. We validated 88 de novo mutations by Sanger sequencing: 35 in French, 21 in Algerian, and 32 in Japanese SZ patients. These 88 de novo mutations exhibited an enrichment in genes encoding proteins related to GO:0051015~actin filament binding (<i>p</i> = 0.0011) using David, and enrichments in GO: 0003774~transport (<i>p</i> = 0.019) and GO:0003729~mRNA binding (<i>p</i> = 0.010) using Amigo. One of these de novo variant was found in <i>CORO1C</i> coding sequence. We studied Coro1c haploinsufficiency in a <i>Coro1c<sup>+/-</sup></i> mouse and found defects in the corpus callosum. These results could motivate future studies of the mechanisms surrounding genes encoding proteins involved in transport and the cytoskeleton, with the goal of developing therapeutic intervention strategies for a subset of SZ cases.

Also flagged:Depressioncoronary heart diseaseinflammatory responseAutonomic Nervous SystemANSplatelet activation
Journal Article 2024-02-09 No Snippets Xu L, Zhai X, Shi D, Zhang Y.
Show Full Abstract

Coronary heart disease (CHD), a cardiovascular condition that poses a significant threat to human health and life, has imposed a substantial economic burden on the world. However, in contrast to conventional risk factors, depression emerges as a novel and independent risk factor for CHD. This condition impacts the onset and progression of CHD and elevates the risk of adverse cardiovascular prognostic events in those already affected by CHD. As a result, depression has garnered increasing global attention. Despite this growing awareness, the specific mechanisms through which depression contributes to the development of CHD remain unclear. Existing research suggests that depression primarily influences the inflammatory response, Hypothalamic-pituitary-adrenocortical axis (HPA) and Autonomic Nervous System (ANS) dysfunction, platelet activation, endothelial dysfunction, lipid metabolism disorders, and genetics, all of which play pivotal roles in CHD development. Furthermore, the effectiveness and safety of antidepressant treatment in CHD patients with comorbid depression and its potential impact on the prognosis of CHD patients have become subjects of controversy. Further investigation is warranted to address these unresolved questions.

Also flagged:methamphetamine use disorderbehavioralMethamphetamineamphetamineMETH use disordermethylenedioxy
Journal Article 2024-02-09 No Snippets Daiwile AP, Cadet JL.
Show Full Abstract

Methamphetamine (METH) is the most commonly misused amphetamine-type stimulant throughout the globe. METH is very rewarding, and its misuse can lead to a diagnosis of METH use disorder (MUD). Although METH use is observed in both sexes, there are, however, reported differences in the clinical manifestations of METH use and its consequences. These observations indicate the need for more research on the long-term sex-dependent consequences of METH taking in both preclinical and clinical settings. In effect, sex is a biological variable that can impact conclusions drawn from various basic and clinical studies. Thus, the present chapter provides a succinct review of the current state of the research on METH and its sex-associated consequences. In addition to behavioral and cognitive aspects of METH use, we discuss METH-induced changes in neurotransmitter systems and structures in the brain. Thus, the book chapter serves to highlight the significance of sex as a critical element that needs to be considered during discussions of novel therapeutic approaches to MUD.

HTT
Also flagged:hereditary neurodegenerative disorderHDaspirinacetylsalicylic acidHuntingtonHuntington Disease
Journal Article 2024-02-09 ✓ 5 Snippets Mondal S, Prieto S, Rangasamy SB, Dutta D, Pahan K.
In-Text Gene Mentions

As expected, the immunostaining results showed marked deposition of Htt in neurons of motor cortex (Figure 4A) and striatum (Figure 4B) of HD mice as compared to nTg mice.

Since N171-82Q mice having an N-terminal fragment of Htt incorporating both exon 1 and exon 2 of the Htt gene with 82 polyglutamine, exhibit behavioral symptoms and protein aggregates at the age of 4 months with a life expectancy of 5–6 months, in this study, we started aspirin nebulization in N171-82Q (HD) mice from the age of 3 months when the animals showed some HD symptoms including loss of coordination and tremors.

The relative contribution of soluble and aggregated forms of Htt to the pathogenesis of HD is still unclear.

Down-regulation of Htt pathology in the striatum and motor cortex of HD mice by aspirin; 3.

To confirm this finding further, we performed Western blot analysis of Htt protein, which also showed a significant decrease in aggregated Htt in the motor cortex (Figure 4E and G) and striatum (Figure 4F and H) of HD mice after aspirin nebulization.

Show Full Abstract

Huntington Disease (HD), a devastating hereditary neurodegenerative disorder, is caused by expanded CAG trinucleotide repeats in the huntingtin gene (<i>Htt</i>) on chromosome 4. Currently, there is no effective therapy for HD. Although aspirin, acetylsalicylic acid, is one of the most widely-used analgesics throughout the world, it has some side effects. Even at low doses, oral aspirin can cause gastrointestinal symptoms, such as heartburn, upset stomach, or pain. Therefore, to bypass the direct exposure of aspirin to stomach, here, we described a new mode of use of aspirin and demonstrated that nebulization of low-dose of aspirin (10 μg/mouse/d=0.4 mg/kg body wt/d roughly equivalent to 28 mg/adult human/d) alleviated HD pathology in N171-82Q transgenic mice. Our immunohistochemical and western blot studies showed that daily aspirin nebulization significantly reduced glial activation, inflammation and huntingtin pathology in striatum and cortex of N171-82Q mice. Aspirin nebulization also protected transgenic mice from brain volume shrinkage and improved general motor behaviors. Collectively, these results highlight that nebulization of low-dose aspirin may have therapeutic potential in the treatment of HD.

Also flagged:tumoroxygenartesunateendoperoxidehydrazoneheme
Journal Article 2024-02-09 No Snippets Tang J, Liu Y, Xue Y, Jiang Z, Chen B, Liu J.
Show Full Abstract

Prodrug-based self-assembled nanoparticles (PSNs) with tailored responses to tumor microenvironments show a significant promise for chemodynamic therapy (CDT) by generating highly toxic reactive oxygen species (ROS). However, the insufficient level of intracellular ROS and the limited drug accumulation remain major challenges for further clinical transformation. In this study, the PSNs for the delivery of artesunate (ARS) are demonstrated by designing the pH-responsive ARS-4-hydroxybenzoyl hydrazide (HBZ)-5-amino levulinic acid (ALA) nanoparticles (AHA NPs) with self-supplied ROS for excellent chemotherapy and CDT. The PSNs greatly improved the loading capacity of artesunate and the ROS generation from endoperoxide bridge using the electron withdrawing group attached directly to C10 site of artesunate. The ALA and ARS-HBZ could be released from AHA NPs under the cleavage of hydrazone bonds triggered by the acidic surroundings. Besides, the ALA increased the intracellular level of heme in mitochondria, further promoting the ROS generation and lipid peroxidation with ARS-HBZ for excellent anti-tumor effects. Our study improved the chemotherapy of ARS through the chemical modification, pointing out the potential applications in the clinical fields.

Research Square 2024-02-09 Preprint (No Snippets API) Harkany T, Tretiakov E, Varela L, Jarc J, Rebernik P, Newbold S, Keimpema E, Verkhratsky A, Horvath T, Romanov R.
Show Full Abstract

<title>Abstract</title> <p><bold>Astrocytes safeguard the homeostasis of the central nervous system</bold><sup>1,2</sup><bold>. Despite their prominent morphological plasticity under conditions that challenge the brain’s adaptive capacity</bold><sup>3–5</sup><bold>, the classification of astrocytes, and relating their molecular make-up to spatially devolved neuronal operations that specify behavior or metabolism, remained mostly futile</bold><sup>6,7</sup><bold>. Although it seems unexpected in the era of single-cell biology, the lack of a major advance in stratifying astrocytes under physiological conditions rests on the incompatibility of ‘neurocentric’ algorithms that rely on stable developmental endpoints, lifelong transcriptional, neurotransmitter, and neuropeptide signatures for classification</bold><sup>6–8</sup><bold> with the dynamic functional states, anatomic allocation, and allostatic plasticity of astrocytes</bold><sup>1</sup><bold>. Simplistically, therefore, astrocytes are still grouped as ‘resting’ vs. ‘reactive’, the latter referring to pathological states marked by various inducible genes</bold><sup>3,9,10</sup><bold>. Here, we introduced a machine learning-based feature recognition algorithm that benefits from the cumulative power of published single-cell RNA-seq data on astrocytes as a reference map to stepwise eliminate pleiotropic and inducible cellular features. For the healthy hypothalamus, this walk-back approach revealed gene regulatory networks (GRNs) that specified subsets of astrocytes, and could be used as landmarking tools for their anatomical assignment. The core molecular censuses retained by astrocyte subsets were sufficient to stratify them by allostatic competence, chiefly their signaling and metabolic interplay with neurons. Particularly, we found differentially expressed mitochondrial genes in insulin-sensing astrocytes and demonstrated their reciprocal signaling with neurons that work antagonistically within the food intake circuitry. As a proof-of-concept, we showed that disrupting </bold><italic><bold>Mfn2</bold></italic><bold> expression in astrocytes reduced their ability to support dynamic circuit reorganization, a time-locked feature of satiety in the hypothalamus, thus leading to obesity in mice. Overall, our results suggest that astrocytes in the healthy brain are fundamentally more heterogeneous than previously thought and topologically mirror the specificity of local neurocircuits.</bold></p>

LRRC7
Also flagged:lipidmetabolismtriglyceridesecretionhepatic steatosisATPase
Journal Article 2024-02-08 ✓ 5 Snippets Hernandez-Ono A, Zhao YP, Murray JW, Östlund C, Lee MJ, Shi A, Dauer WT, Worman HJ, Ginsberg HN, Shin JY.
In-Text Gene Mentions

…a U6 promoter (Ad-Lap1) for in vivo…

…the efficiency of Ad-Lap1, we transduced cultured…

…epatocytes transduced with Ad-Lap1( Supplemental Figure…

…the efficacy of Ad-Lap1in depleting LAP1,…

…mice treated with Ad-Lap1had reductions in…

Show Full Abstract

Depletion of torsinA from hepatocytes leads to reduced liver triglyceride secretion and marked hepatic steatosis. TorsinA is an atypical ATPase that lacks intrinsic activity unless it is bound to its activator, lamina-associated polypeptide 1 (LAP1) or luminal domain-like LAP1 (LULL1). We previously demonstrated that depletion of LAP1 from hepatocytes has more modest effects on liver triglyceride secretion and steatosis development than depletion of torsinA. We now show that depletion of LULL1 alone does not significantly decrease triglyceride secretion or cause steatosis. However, simultaneous depletion of both LAP1 and LULL1 leads to defective triglyceride secretion and marked steatosis similar to that observed with depletion of torsinA. Depletion of both LAP1 and torsinA from hepatocytes generated phenotypes similar to those observed with only torsinA depletion, implying that the 2 proteins act in the same pathway in liver lipid metabolism. Our results demonstrate that torsinA and its activators dynamically regulate hepatic lipid metabolism.

HFE
Also flagged:osteopeniacalcium pyrophosphatecrystal arthritisGlucocorticoidsosteoporosisarthritis
Journal Article 2024-02-08 ✓ 1 Snippet Tedeschi SK, Hayashi K, Rosenthal A, Gill M, Marrugo J, Fukui S, Gravallese E, Solomon DH.
In-Text Gene Mentions

hemochromatosis

Show Full Abstract

<h4>Objective</h4>Calcium pyrophosphate deposition (CPPD) disease was associated with osteopenia in two cross-sectional studies. We compared fracture risks in patients with acute calcium pyrophosphate (CPP) crystal arthritis versus matched comparators.<h4>Methods</h4>We performed a longitudinal cohort study using electronic health record data from a single large academic health system, with data from 1991 to 2023. Patients with one or more episodes of acute CPP crystal arthritis were matched to comparators on the index date (first documentation of "pseudogout" or synovial fluid CPP crystals or matched encounter) and first encounter in the health system. The primary outcome was first fracture at the humerus, wrist, hip, or pelvis. We excluded patients with fracture before the index date. Covariates included demographics, body mass index, smoking, comorbidities, health care use, glucocorticoids, and osteoporosis treatments. We estimated incidence rates and adjusted hazard ratios for fracture. Sensitivity analyses excluded patients prescribed glucocorticoids, patients prescribed osteoporosis treatments, or patients with rheumatoid arthritis and additionally adjusted for chronic kidney disease.<h4>Results</h4>We identified 1,148 patients with acute CPP crystal arthritis matched to 3,730 comparators, with a mean age of 73 years. Glucocorticoids and osteoporosis treatments were more frequent in the acute CPP crystal arthritis cohort. Fracture incidence rates were twice as high in the acute CPP crystal arthritis cohort (11.7 per 1,000 person-years) versus comparators (5.5 per 1,000 person-years). After multivariable adjustment, fracture relative risk was twice as high in the acute CPP crystal arthritis cohort (hazard ratio 1.8 [95% confidence interval 1.3-2.3]); results were similar in sensitivity analyses.<h4>Conclusion</h4>In this first published study of fractures and CPPD, fracture risk was nearly doubled in patients with acute CPP crystal arthritis.

Also flagged:BPESR1INSRCDK6CSKNOS3
Journal Article 2024-02-08 No Snippets Tsare EG, Klapa MI, Moschonas NK.
Show Full Abstract

<h4>Background</h4>It is valuable to analyze the genome-wide association studies (GWAS) data for a complex disease phenotype in the context of the protein-protein interaction (PPI) network, as the related pathophysiology results from the function of interacting polyprotein pathways. The analysis may include the design and curation of a phenotype-specific GWAS meta-database incorporating genotypic and eQTL data linking to PPI and other biological datasets, and the development of systematic workflows for PPI network-based data integration toward protein and pathway prioritization. Here, we pursued this analysis for blood pressure (BP) regulation.<h4>Methods</h4>The relational scheme of the implemented in Microsoft SQL Server BP-GWAS meta-database enabled the combined storage of: GWAS data and attributes mined from GWAS Catalog and the literature, Ensembl-defined SNP-transcript associations, and GTEx eQTL data. The BP-protein interactome was reconstructed from the PICKLE PPI meta-database, extending the GWAS-deduced network with the shortest paths connecting all GWAS-proteins into one component. The shortest-path intermediates were considered as BP-related. For protein prioritization, we combined a new integrated GWAS-based scoring scheme with two network-based criteria: one considering the protein role in the reconstructed by shortest-path (RbSP) interactome and one novel promoting the common neighbors of GWAS-prioritized proteins. Prioritized proteins were ranked by the number of satisfied criteria.<h4>Results</h4>The meta-database includes 6687 variants linked with 1167 BP-associated protein-coding genes. The GWAS-deduced PPI network includes 1065 proteins, with 672 forming a connected component. The RbSP interactome contains 1443 additional, network-deduced proteins and indicated that essentially all BP-GWAS proteins are at most second neighbors. The prioritized BP-protein set was derived from the union of the most BP-significant by any of the GWAS-based or the network-based criteria. It included 335 proteins, with ~ 2/3 deduced from the BP PPI network extension and 126 prioritized by at least two criteria. ESR1 was the only protein satisfying all three criteria, followed in the top-10 by INSR, PTN11, CDK6, CSK, NOS3, SH2B3, ATP2B1, FES and FINC, satisfying two. Pathway analysis of the RbSP interactome revealed numerous bioprocesses, which are indeed functionally supported as BP-associated, extending our understanding about BP regulation.<h4>Conclusions</h4>The implemented workflow could be used for other multifactorial diseases.

HFE
Also flagged:liver fibrosisHyperferritinemiaironalcoholliver diseasemetabolism
Journal Article 2024-02-08 ✓ 1 Snippet Männistö VT, Hakkarainen K, Jula A, Lundqvist A, Vihervaara T, Erlund I, Åberg F.
In-Text Gene Mentions

…outcomes independent of <i>HFE</i> genotype in the…

Show Full Abstract

<h4>Background & aims</h4>Hyperferritinemia reflects iron accumulation in the body and has been associated with metabolic disturbances and alcohol use, and is also a common finding in individuals diagnosed with liver disease. The major genetic regulator of iron metabolism is the <i>HFE</i> gene.<h4>Methods</h4>The aim of this this study was to investigate the association between serum ferritin and liver fibrosis using the enhanced liver fibrosis (ELF) test, and the association between ferritin and liver-related outcomes in a Finnish population-based cohort of 6194 individuals (45% male, mean [± standard deviation] age, 52.9 ± 14.9 years; body mass index 26.9 ± 4.7 kg/m<sup>2</sup>). The effects of <i>HFE</i> variants on these associations were also evaluated.<h4>Results</h4>Serum ferritin levels were significantly associated with liver fibrosis, as estimated by enhanced liver fibrosis (ELF) test in weighted linear regression analysis. Serum ferritin was significantly associated with both all liver-related outcomes (<i>n</i> = 92) and severe liver-related outcomes (<i>n</i> = 54) in weighted Cox regression analysis (hazard ratio [HR] per 1 SD, 1.11 [95% confidence interval (CI) 1.02-1.21]; <i>p</i> = 0.012 and HR 1.11 [95% CI 1.02-1.21]; <i>p</i> = 0.013, respectively). However, there was association neither between <i>HFE</i> risk variants and ELF test nor between <i>HFE</i> risk variants and liver-related outcomes.<h4>Conclusion</h4>Serum ferritin levels were associated with liver fibrosis and incident liver disease, independent of <i>HFE</i> genotype in the general population. Furthermore, data demonstrated that metabolic disturbances and alcohol use were major risk factors for hyperferritinemia.

Also flagged:A andwaterhepatitis Areverse-transcriptionGlutamatechloro
Journal Article 2024-02-08 No Snippets Campos CJA, Gyawali P, Hewitt J.
Show Full Abstract

Viral testing combined with hydrographic studies is considered standard good practice in determining microbiological impacts on shellfish growing areas following wastewater overflows. In this study, norovirus genogroup I and II, indicators of viral contamination (F-RNA bacteriophage genogroup II (F-RNA GII), crAssphage, pepper mild mottle virus) and Escherichia coli were monitored during periods of normal harvesting and following overflows in two commercial shellfish growing areas in Otago Harbour (Aotearoa New Zealand). Dye tracing, drogue tracking and analysis of particle tracking modelling were also undertaken to assess the dispersion, dilution and time of travel of wastewater discharged from a pump station discharge that impacts the growing areas. Norovirus was not detected in any of the 218 shellfish samples tested. PMMoV and crAssphage were more prevalent than F-RNA GII as determined by RT-qPCR. The dye study indicated long residence time of the waters (≥5 days) in the embayment impacted by the discharge. No relationships were found between the concentrations of viral indicators or E. coli and wastewater dilution, distance between the discharge and the growing areas or time since the last overflow. For the three spills studied (≤327 m<sup>3</sup>), there was little evidence of microbiological impact on the growing areas. This was likely associated with a deep shipping channel that enhances water flushing in the harbour and reduces contaminant transport to the growing areas. We recommend flexibility in the approach for closure/reopening growing areas impacted by spills, particularly for small duration/volume spills and when norovirus is not present in the community.

SERPINC1
Also flagged:cancertumorepoxy-fatty acidssoluble epoxide hydrolaseomega-3 polyunsaturated fatty acidcytokine
Journal Article 2024-02-08 ✓ 1 Snippet Kelly AG, Wang W, Rothenberger E, Yang J, Gilligan MM, Kipper FC, Attaya A, Gartung A, Hwang SH, Gillespie MJ, Bayer RL, Quinlivan KM, Torres KL, Huang S, Mitsiades N, Yang H, Hammock BD, Panigrahy D.
In-Text Gene Mentions

…(bladder cancer), andTRAMP C1C1 (prostate cancer)…

Show Full Abstract

Cancer therapy, including immunotherapy, is inherently limited by chronic inflammation-induced tumorigenesis and toxicity within the tumor microenvironment. Thus, stimulating the resolution of inflammation may enhance immunotherapy and improve the toxicity of immune checkpoint inhibition (ICI). As epoxy-fatty acids (EpFAs) are degraded by the enzyme soluble epoxide hydrolase (sEH), the inhibition of sEH increases endogenous EpFA levels to promote the resolution of cancer-associated inflammation. Here, we demonstrate that systemic treatment with ICI induces sEH expression in multiple murine cancer models. Dietary omega-3 polyunsaturated fatty acid supplementation and pharmacologic sEH inhibition, both alone and in combination, significantly enhance anti-tumor activity of ICI in these models. Notably, pharmacological abrogation of the sEH pathway alone or in combination with ICI counter-regulates an ICI-induced pro-inflammatory and pro-tumorigenic cytokine storm. Thus, modulating endogenous EpFA levels through dietary supplementation or sEH inhibition may represent a unique strategy to enhance the anti-tumor activity of paradigm cancer therapies.

Also flagged:Primary aldosteronismsecondary hypertensionhypertensionrefractory hypertensionsecretionaldosterone
Journal Article 2024-02-08 No Snippets Wen D, Peng P, Yue X, Xu C, Pu Q, Ming Y, Yang H, Zhang M, Ren Y, Sun J.
Show Full Abstract

<h4>Purpose</h4>To compare the ability of diffusion parameters obtained by stretched-exponential and kurtosis models of diffusion-weighted imaging (DWI) to distinguish between patients with primary aldosteronism (PA) and healthy controls (HCs) in renal assessment.<h4>Materials and methods</h4>A total of 44 participants (22 patients and 22 HCs) underwent renal MRI with an 11 b-value DWI sequence and a 3 b-value diffusion kurtosis imaging (DKI) sequence from June 2021 to April 2022. Binary logistic regression was used to construct regression models combining different diffusion parameters. Receiver-operating characteristic (ROC) curve analysis and comparisons were used to evaluate the ability of single diffusion parameters and combined diffusion models to distinguish between the two groups.<h4>Results</h4>A total of six diffusion parameters (including the cortical anomalous exponent term [α_Cortex], medullary fractional anisotropy [FA_Medulla], cortical FA [FA_Cortex], cortical axial diffusivity [Da_Cortex], medullary mean diffusivity [MD_Medulla] and medullary radial diffusivity [Dr_Medulla]) were included, and 10 regression models were studied. The area under the curve (AUC) of Dr_Medulla was 0.855, comparable to that of FA_Cortex and FA_Medulla and significantly higher than that of α_Cortex, Da_Cortex and MD_Medulla. The AUC of the Model_all parameters was 0.967, comparable to that of Model_FA (0.946) and Model_DKI (0.966) and significantly higher than that of the other models. The sensitivity and specificity of Model_all parameters were 87.2% and 95%, respectively.<h4>Conclusion</h4>The Model_all parameters, Model_FA and Model_DKI were valid for differentiating between PA patients and HCs with similar differentiation efficacy and were superior to single diffusion parameters and other models.

Also flagged:gastroenteritischloramphenicolgentamicinkanamycinlincomycinstreptomycin
Journal Article 2024-02-08 No Snippets Zarske M, Luu HQ, Deneke C, Knüver MT, Thieck M, Hoang HTT, Bretschneider N, Pham NT, Huber I, Stingl K.
Show Full Abstract

<h4>Background</h4>Campylobacter spp. is the most frequent cause of bacterial food-borne gastroenteritis and a high priority antibiotic resistant bacterium according to the World Health Organization (WHO). European monitoring of thermotolerant Campylobacter spp. does not reflect the global burden of resistances already circulating within the bacterial population worldwide.<h4>Methods</h4>We systematically compared whole genome sequencing with comprehensive phenotypic antimicrobial susceptibility, analyzing 494 thermotolerant Campylobacter poultry isolates from Vietnam and Germany. Any discrepancy was checked by repeating the wet lab and improving the dry lab part. Selected isolates were additionally analyzed via long-read Oxford Nanopore technology, leading to closed chromosomes and plasmids.<h4>Results</h4>Overall, 22 different resistance genes and gene variants (e. g. erm(B), aph(3')-IIIa, aph(2'')-If, catA, lnu(C), bla<sub>OXA</sub>, sat4) and point mutations in three distinct genes (gyrA, 23S rRNA, rpsL) associated with AMR were present in the Campylobacter isolates. Two AMR genes were missing in the database and one falsely associated with resistance. Bioinformatic analysis based on short-read data partly failed to identify tet(O) and aadE, when the genes were present as duplicate or homologous gene variants. Intriguingly, isolates also contained different determinants, redundantly conferring resistance to chloramphenicol, gentamicin, kanamycin, lincomycin and streptomycin. We found a novel tet(W) in tetracycline sensitive strains, harboring point mutations. Furthermore, analysis based on assemblies from short-read data was impaired to identify full length phase variable aad9, due to variations of the poly-C tract within the gene. The genetic determinant responsible for gentamicin resistance of one isolate from Germany could not be identified. GyrT86I, presenting the main determinant for (fluoro-)quinolone resistance led to a rare atypical phenotype of ciprofloxacin resistance but nalidixic acid sensitivity. Long-read sequencing predicted AMR genes were mainly located on the chromosome, and rarely on plasmids. Predictions from long- and short-read sequencing, respectively, often differed. AMR genes were often organized in multidrug resistance islands (MDRI) and partially located in proximity to transposase genes, suggesting main mobilization of resistance determinants is via natural transformation and transposition in Campylobacter.<h4>Conclusions</h4>The results of this study suggest that there is frequent resistance gene duplication, mosaicism, and mutation leading to gene variation and truncation in Campylobacter strains that have not been reported in previous studies and are missing from databases. Furthermore, there is a need for deciphering yet unknown resistance mechanisms and resistance spread in thermotolerant Campylobacter spp. that may pose a challenge to global food safety.

POU3F2
Also flagged:axonsmembranesmyelin sheathorganelleneurodegenerative diseasesmultiple sclerosis
Journal Article 2024-02-08 ✓ 3 Snippets Xu J, Peng Q, Cai J, Shangguan J, Su W, Chen G, Sun H, Zhu C, Gu Y.
In-Text Gene Mentions

…Myrf, Pou3f1 andPou3f2).…

…factors (Egr2, Pou3f1,Pou3f2and Id2), and…

…such as Olig1,Pou3f2, and Egr2, even…

Show Full Abstract

Myelin sheath abnormality is the cause of various neurodegenerative diseases (NDDs). G-proteins and their coupled receptors (GPCRs) play the important roles in myelination. Gnao1, encoding the major Gα protein (Gαo) in mammalian nerve system, is required for normal motor function. Here, we show that Gnao1 restricted to Schwann cell (SCs) lineage, but not neurons, negatively regulate SC differentiation, myelination, as well as re-myelination in peripheral nervous system (PNS). Mice lacking Gnao1 expression in SCs exhibit faster re-myelination and motor function recovery after nerve injury. Conversely, mice with Gnao1 overexpression in SCs display the insufficient myelinating capacity and delayed re-myelination. In vitro, Gnao1 deletion in SCs promotes SC differentiation. We found that Gnao1 knockdown in SCs resulting in the elevation of cAMP content and the activation of PI3K/AKT pathway, both associated with SC differentiation. The analysis of RNA sequencing data further evidenced that Gnao1 deletion cause the increased expression of myelin-related molecules and activation of regulatory pathways. Taken together, our data indicate that Gnao1 negatively regulated SC differentiation by reducing cAMP level and inhibiting PI3K-AKT cascade activation, identifying a novel drug target for the treatment of demyelinating diseases.

Also flagged:APOA5hypertriglyceridemiaacute pancreatitisbiliary acute pancreatitisBAPapolipoprotein A-V
Journal Article 2024-02-08 No Snippets Liu Y, Dai S, Qin S, Zhou J, Wang Z, Yin G.
Show Full Abstract

<h4>Background and aims</h4>To study the role of gene mutations in the development of severe hypertriglyceridemia (HTG) in patients with hyperlipidemic acute pancreatitis (HLAP), especially different apolipoprotein A5 (APOA5) mutations.<h4>Methods</h4>Whole-exome sequencing was performed on 163 patients with HLAP and 30 patients with biliary acute pancreatitis (BAP). The pathogenicity of mutations was then assessed by combining clinical information, predictions of bioinformatics programs, information from multiple gene databases, and residue location and conservation. The pathogenic mutations of APOA5 were visualized using the software.<h4>Results</h4>1. Compared with BAP patients, pathogenic mutations of APOA5 were frequent in HLAP patients; among them, the heterozygous mutation of p.G185C was the most common. 2. All six pathogenic mutations of APOA5 identified in this study (p.S35N, p.D167V, p.G185C, p.K188I, p.R223C, and p.H182fs) were positively correlated with severe HTG; they were all in the important domains of apolipoprotein A-V (apoA-V). Residue 223 is strictly conserved in multiple mammals and is located in the lipoprotein lipase (LPL)-binding domain (Pro215-Phe261). When Arg 223 is mutated to Cys 223, the positive charge of this residue is reduced, which is potentially destructive to the binding function of apoA-V to LPL. 3. Four new APOA5 mutations were identified, namely c.563A > T, c.667C > T, c.788G > A, and c.544_545 insGGTGC.<h4>Conclusions</h4>The pathogenic mutations of APOA5 were specific to the patients with HLAP and severe HTG in China, and identifying such mutations had clinical significance in elucidating the etiology and subsequent treatment.

Also flagged:saltCATAPXGPXwaterseed germination
Journal Article 2024-02-08 No Snippets Amin F, Shah F, Ullah S, Shah W, Ahmed I, Ali B, Khan AA, Malik T, Mustafa AEMA.
Show Full Abstract

The maize (Zea mays L.) is a monocot that is a member of the Poaceae family and a valuable feed for livestock, human food, and raw material for various industries. The halothermal time model determines how plants respond to salt (NaCl) stress under sub-optimal conditions. This model examines the relation between NaClb (g), GR, GP, salinity and temperature stress on germination of seeds dynamics in various crops. Five constant temperatures i.e. 20, 25, 30, 35, and 40 °C and five ψ levels (NaCl concentrations converted to ψ - 0, - 0.2, - 0.4, - 0.6, and - 0.8 MPa) were used in this experiment. In light of the results, the maximum halo-thermal time constant value was recorded at 35 °C temperature, while maximum germination percentage was detected at 30 °C in the controlled condition. Moreover, the lowermost value was recorded at 20 °C at - 0.8 MPa osmotic potential. The highest CAT, APX, and GPX activities were recorded at 15 °C at - 0.8 MPa, while the lowest values were observed for 0 MPa at 30 °C temperature. In conclusion, by employing the halo thermal time model, the germination of maize variety (var.30W52) was accurately predicted for the first time under varying levels of temperature and osmotic potentials.

Also flagged:DDHD2spastic paraplegia type 54lipophagyHereditary spastic paraplegianeurodegenerative disorderslipid droplets
Journal Article 2024-02-08 No Snippets Jia F, Wang X, Fu Y, Zhao SM, Lu B, Wang C.
Show Full Abstract

Hereditary spastic paraplegia (HSP) is a group of inherited neurodegenerative disorders characterized by progressive lower limb spasticity and weakness. One subtype of HSP, known as SPG54, is caused by biallelic mutations in the DDHD2 gene. The primary pathological feature observed in patients with SPG54 is the massive accumulation of lipid droplets (LDs) in the brain. However, the precise mechanisms and roles of DDHD2 in regulating lipid homeostasis are not yet fully understood. Through Affinity Purification-Mass Spectroscopy (AP-MS) analysis, we identify that DDHD2 interacts with multiple members of the ATG8 family proteins (LC3, GABARAPs), which play crucial roles in lipophagy. Mutational analysis reveals the presence of two authentic LIR motifs in DDHD2 protein that are essential for its binding to LC3/GABARAPs. We show that DDHD2 deficiency leads to LD accumulation, while enhanced DDHD2 expression reduces LD formation. The LC3/GABARAP-binding capacity of DDHD2 and the canonical autophagy pathway both contribute to its LD-eliminating activity. Moreover, DDHD2 enhances the colocalization between LC3B and LDs to promote lipophagy. LD·ATTEC, a small molecule that tethers LC3 to LDs to enhance their autophagic clearance, effectively counteracts DDHD2 deficiency-induced LD accumulation. These findings provide valuable insights into the regulatory roles of DDHD2 in LD catabolism and offer a potential therapeutic approach for treating SPG54 patients.

ZNFX1
Also flagged:mycobacterial diseasesMSMDLymphadenopathysepsisIL12RB1IFNGR1
Journal Article 2024-02-08 ✓ 1 Snippet Khavandegar A, Mahdaviani SA, Zaki-Dizaji M, Khalili-Moghaddam F, Ansari S, Alijani S, Taherzadeh-Ghahfarrokhi N, Mansouri D, Casanova JL, Bustamante J, Jamee M.
In-Text Gene Mentions

ZNFX1

Show Full Abstract

<h4>Background</h4>Mendelian susceptibility to mycobacterial diseases (MSMD) is a rare clinical syndrome characterized by vulnerability to weakly virulent mycobacterial species, including Bacillus Calmette-Guérin (BCG) vaccines and environmental mycobacteria.<h4>Objective</h4>We sought to perform a systematic review of the genetic, immunologic, and clinical findings for reported patients with MSMD.<h4>Methods</h4>We searched PubMed, Web of Science, and Scopus databases for publications in English relating to MSMD. All full texts were evaluated for eligibility for inclusion. Two reviewers independently selected the publications, with a third reviewer consulted in cases of disagreement.<h4>Results</h4>A primary systematic search and searches of other resources identified 16,155 articles. In total, 158 articles from 63 countries were included in qualitative and quantitative analyses. In total, 830 patients-436 males (52.5%), 369 females (44.5%), and 25 patients of unknown sex (3.0%)-from 581 families were evaluated. A positive family history was reported in 347 patients (45.5%). The patients had a mean age of 10.41 ± 0.42 (SEM) years. The frequency of MSMD was highest in Iran, Turkey, and Saudi Arabia. Lymphadenopathy was the most common clinical manifestation of MSMD, reported in 378 (45.5%) cases and multifocal in 35.1%. Fever, organomegaly, and sepsis were the next most frequent findings, reported in 251 (30.2%), 206 (24.8%), and 171 (20.8%) cases, respectively. In total, 299 unique mutations in 21 genes known to be involved in MSMD were reported: 100 missense (34%), 80 indel-frameshift (insertion or deletion, 27%), 53 nonsense (18%), 35 splice site (12%), 10 indel-in frame (2.7%), 6 indel (2%), and 15 large deletion/duplication mutations. Finally, 61% of the reported patients with MSMD had mutations of IL12RB1 (41%) or IFNGR1 (20%). At the time of the report, 177 of the patients (21.3%) were dead and 597 (71.9%) were still alive.<h4>Conclusions</h4>MSMD is associated with a high mortality rate, mostly due to impaired control of infection. Preexposure strategies, such as changes in vaccination policy in endemic areas, the establishment of a worldwide registry of patients with MSMD, and precise follow-up over generations in affected families, appear to be vital to decrease MSMD-related mortality.

PRDX6
Also flagged:DDAH1peroxiredoxin 1sulfiredoxin 1dimethylarginine dimethylaminohydrolase 1degradationPRDX1
Journal Article 2024-02-08 ✓ 5 Snippets Yuan J, Yu Z, Zhang P, Luo K, Xu Y, Lan T, Zhang M, Chen Y, Lu Z.
In-Text Gene Mentions

…PRDX1, PRDX4, andPRDX6were identified in…

…PRDX1, PRDX4, andPRDX6but not with…

…the PRDX4 andPRDX6levels were not…

…and that ofPRDX6further decreased (…

…expression and decreasedPRDX6expression in mice…

Show Full Abstract

Growing evidence suggests that dimethylarginine dimethylaminohydrolase 1 (DDAH1), a crucial enzyme for the degradation of asymmetric dimethylarginine (ADMA), is closely related to oxidative stress during the development of multiple diseases. However, the underlying mechanism by which DDAH1 regulates the intracellular redox state remains unclear. In the present study, DDAH1 was shown to interact with peroxiredoxin 1 (PRDX1) and sulfiredoxin 1 (SRXN1), and these interactions could be enhanced by oxidative stress. In HepG2 cells, H<sub>2</sub>O<sub>2</sub>-induced downregulation of DDAH1 and accumulation of ADMA were attenuated by overexpression of PRDX1 or SRXN1 but exacerbated by knockdown of PRDX1 or SRXN1. On the other hand, DDAH1 also maintained the expression of PRDX1 and SRXN1 in H<sub>2</sub>O<sub>2</sub>-treated cells. Furthermore, global knockout of Ddah1 (Ddah1<sup>-/-</sup>) or liver-specific knockout of Ddah1 (Ddah1<sup>HKO</sup>) exacerbated, while overexpression of DDAH1 alleviated liver dysfunction, hepatic oxidative stress and downregulation of PRDX1 and SRXN1 in CCl<sub>4</sub>-treated mice. Overexpression of liver PRDX1 improved liver function, attenuated hepatic oxidative stress and DDAH1 downregulation, and diminished the differences between wild type and Ddah1<sup>-/-</sup> mice after CCl<sub>4</sub> treatment. Collectively, our results suggest that the regulatory effect of DDAH1 on cellular redox homeostasis under stress conditions is due, at least in part, to the interaction with PRDX1 and SRXN1.

OLFM4
Also flagged:metabolismgene expressionanorexiaLgr5peptide transporterMuc2
Journal Article 2024-02-08 ✓ 5 Snippets Kinstler SR, Cloft SE, Siegel PB, Honaker CF, Maurer JJ, Wong EA.
In-Text Gene Mentions

…were measured fromOlfm4stained images using…

…mRNA abundance forOlfm4, stem cell marker…

…olfactomedin 4 (Olfm4).…

…Olfactomedin 4 (Olfm4) is a…

Olfm4is a secreted…

Show Full Abstract

The early posthatch period is crucial to intestinal development, shaping long-term growth, metabolism, and health of the chick. The objective of this study was to determine the effect of genetic selection on morphological characteristics and gene expression during early intestinal development. Populations of White Plymouth Rocks have been selected for high weight (HWS) and low weight (LWS) for over 63 generations, and some LWS display symptoms of anorexia. Intestinal structure and function of these populations were compared to a commercial broiler Cobb 500 (Cobb) during the perihatch period. Egg weights, yolk-free embryo BW, yolk weights, and jejunal samples from HWS, LWS, and Cobb were collected on embryonic day (e) 17, e19, day of hatch, day (d) 3, d5, and d7 posthatch for histology and gene expression analysis. The RNAscope in-situ hybridization method was used to localize expression of the stem cell marker, olfactomedin 4 (Olfm4). Villus height (VH), crypt depth (CD), and VH/CD were measured from Olfm4 stained images using ImageJ. mRNA abundance for Olfm4, stem cell marker Lgr5, peptide transporter PepT1, goblet cell marker Muc2, marker of proliferation Ki67, and antimicrobial peptide LEAP2 were examined. Two-factor ANOVA was performed for measurements and Turkey's HSD was used for mean separation when appropriate. Cobb were heaviest and LWS the lightest (P < 0.01). at each timepoint. VH increased in Cobb and CD increased in HWS compared to LWS (P < 0.01). PepT1 mRNA was upregulated in LWS (P < 0.01), and Muc2 mRNA was decreased in both HWS and LWS compared to Cobb (P < 0.01). Selection for high or low 8-wk body weight has caused differences in intestinal gene expression and morphology when compared to a commercial broiler.

PCDH17
Also flagged:Diabetesmetabolic diseasehyperglycemiadiabetic complicationsDiabetic nephropathyretinopathy
Journal Article 2024-02-08 ✓ 1 Snippet Geng M, Liu W, Li J, Yang G, Tian Y, Jiang X, Xin Y.
In-Text Gene Mentions

Protocadherin 17 (PCDH17), which belongs to the protocadherin gene family, has been evidenced to be linked with the activation of autophagy in cancer cells (66, 67).

Show Full Abstract

Diabetes is a metabolic disease characterized by hyperglycemia, which induces the production of AGEs, ROS, inflammatory cytokines, and growth factors, leading to the formation of vascular dysfunction and target organ damage, promoting the development of diabetic complications. Diabetic nephropathy, retinopathy, and cardiomyopathy are common complications of diabetes, which are major contributors to disability and death in people with diabetes. Long non-coding RNAs affect gene transcription, mRNA stability, and translation efficiency to influence gene expression for a variety of biological functions. Over the past decade, it has been demonstrated that dysregulated long non-coding RNAs are extensively engaged in the pathogenesis of many diseases, including diabetic complications. Thus, this review discusses the regulations of long non-coding RNAs on the primary pathogenesis of diabetic complications (oxidative stress, inflammation, fibrosis, and microvascular dysfunction), and some of these long non-coding RNAs may function as potential biomarkers or therapeutic targets for diabetic complications.

FBXL4
Also flagged:Mitochondriamitochondrialplacental disorderspreeclampsiafoetal growth restrictionplacenta-
Journal Article 2024-02-08 ✓ 1 Snippet Wu Y, Li M, Ying H, Gu Y, Zhu Y, Gu Y, Huang L.
In-Text Gene Mentions

F-Box and Leucine-rich repeat protein 4and Leucine-rich repeat…

Show Full Abstract

Mitochondria are ubiquitous in eukaryotic cells. Normal maintenance of function is the premise and basis for various physiological activities. Mitochondrial dysfunction is commonly observed in a wide range of pathological conditions, such as neurodegenerative, metabolic, cardiovascular, and various diseases related to foetal growth and development. The placenta is a highly energy-dependent organ that acts as an intermediary between the mother and foetus and functions to maintain foetal growth and development. Recent studies have demonstrated that mitochondrial dysfunction is associated with placental disorders. Defects in mitochondrial quality control mechanisms may lead to preeclampsia and foetal growth restriction. In this review, we address the quality control mechanisms of mitochondria and the relevant pathologies of mitochondrial dysfunction in placenta-related diseases, such as preeclampsia and foetal growth restriction. This review also investigates the relation between mitochondrial dysfunction and placental disorders.

Also flagged:extracellularCarbon dioxideacidbicarbonatephosphatescalcium
Journal Article 2024-02-08 No Snippets Salcedo-Betancourt JD, Moe OW.
Show Full Abstract

A variety of changes in mineral metabolism aiming to restore acid-base balance occur in acid loading and metabolic acidosis. Phosphate plays a key role in defense against metabolic acidosis, both as an intracellular and extracellular buffer, as well as in the renal excretion of excess acid in the form of urinary titratable acid. The skeleton acts as an extracellular buffer in states of metabolic acidosis, as the bone matrix demineralizes, leading to bone apatite dissolution and the release of phosphate, calcium, carbonate, and citrate into the circulation. The renal handling of calcium, phosphate and citrate is also affected, with resultant hypercalciuria, hyperphosphaturia and hypocitraturia.

HTT
Also flagged:tumorscancermetabolismnicotinamide phosphoribosyltransferaseNAMPTtumor
Journal Article 2024-02-08 ✓ 1 Snippet Ghanem MS, Caffa I, Monacelli F, Nencioni A.
In-Text Gene Mentions

…of mutant Huntingtin (Htt) aggregation [ 123…

Show Full Abstract

The addiction of tumors to elevated nicotinamide adenine dinucleotide (NAD<sup>+</sup>) levels is a hallmark of cancer metabolism. Obstructing NAD<sup>+</sup> biosynthesis in tumors is a new and promising antineoplastic strategy. Inhibitors developed against nicotinamide phosphoribosyltransferase (NAMPT), the main enzyme in NAD<sup>+</sup> production from nicotinamide, elicited robust anticancer activity in preclinical models but not in patients, implying that other NAD<sup>+</sup>-biosynthetic pathways are also active in tumors and provide sufficient NAD<sup>+</sup> amounts despite NAMPT obstruction. Recent studies show that NAD<sup>+</sup> biosynthesis through the so-called "Preiss-Handler (PH) pathway", which utilizes nicotinate as a precursor, actively operates in many tumors and accounts for tumor resistance to NAMPT inhibitors. The PH pathway consists of three sequential enzymatic steps that are catalyzed by nicotinate phosphoribosyltransferase (NAPRT), nicotinamide mononucleotide adenylyltransferases (NMNATs), and NAD<sup>+</sup> synthetase (NADSYN1). Here, we focus on these enzymes as emerging targets in cancer drug discovery, summarizing their reported inhibitors and describing their current or potential exploitation as anticancer agents. Finally, we also focus on additional NAD<sup>+</sup>-producing enzymes acting in alternative NAD<sup>+</sup>-producing routes that could also be relevant in tumors and thus become viable targets for drug discovery.

MLLT10
Also flagged:Acute Myeloid Leukemiasolid tumorsleukemiasAMLPediatricacute leukemia
Journal Article 2024-02-08 ✓ 2 Snippets Stevens AM, Terrell M, Rashid R, Fisher KE, Marcogliese AN, Gaikwad A, Rao P, Vrana C, Krueger M, Loken M, Menssen AJ, Cook JA, Keogh N, Alozie M, Oviedo H, Gonzalez AK, Ilangovan T, Kim J, Sandhu S, Redell MS.
In-Text Gene Mentions

…These models harbor PICALM::MLLT10and RAD21 mutations,…

…patient with a PICALM::MLLT10fusion, ETV6 loss,…

Show Full Abstract

The survival rate of pediatric acute myeloid leukemia (pAML) is currently around 60%. While survival has slowly increased over the past few decades, the development of novel agents likely to further improve survival for this heterogeneous patient population has been limited by gaps in the pAML pre-clinical pipeline. One of the major hurdles in evaluating new agents for pAML is the lack of pAML patient-derived xenograft (PDX) models. Unlike solid tumors and other types of leukemias, AML is notoriously hard to establish in mouse models, likely due in part to the need for specific human microenvironment elements. Our laboratory at TCH/BCM addressed this gap by establishing a systematic PDX workflow, leveraging advanced immunodeficient hosts and capitalizing on our high volume of pAML patients and close coordination between labs and clinical sections. Patients treated at TCH are offered the chance to participate in specimen banking protocols that allow blood and bone marrow collection as well as the collection of relevant clinical data. All patients who consent and have samples available are trialed for PDX development. In addition, samples from the Children's Oncology Group (COG) are also trialed for PDX generation. Serially transplanting PDX models are validated using short tandem repeat (STR) and characterized using both targeted DNA/RNA next generation sequencing and RNAseq. As of March 2023, this systematic approach has resulted in 26 serially transplanting models. Models have been shared with requesting labs to facilitate external pAML pre-clinical studies. Available PDX models can be located through the BCM PDX Portal. We expect our growing PDX resource to make a significant contribution to expediting the testing of promising novel therapeutics for pAML.

HFE
Also flagged:SynthesisNon-alcoholic fatty liver diseaseNAFLDchronic liver diseaseliver diseasesteatotic liver disease
Journal Article 2024-02-08 ✓ 1 Snippet Soto A, Spongberg C, Martinino A, Giovinazzo F.
In-Text Gene Mentions

Specifically, the findings indicated that individuals with mutations in the HFE gene (C282Y/C282Y and C282Y/H63D) do not exhibit a higher risk of MASLD compared to controls.

Show Full Abstract

Non-alcoholic fatty liver disease (NAFLD) is a widespread contributor to chronic liver disease globally. A recent consensus on renaming liver disease was established, and metabolic dysfunction-associated steatotic liver disease, MASLD, was chosen as the replacement for NAFLD. The disease's range extends from the less severe MASLD, previously known as non-alcoholic fatty liver (NAFL), to the more intense metabolic dysfunction-associated steatohepatitis (MASH), previously known as non-alcoholic steatohepatitis (NASH), characterized by inflammation and apoptosis. This research project endeavors to comprehensively synthesize the most recent studies on MASLD, encompassing a wide spectrum of topics such as pathophysiology, risk factors, dietary influences, lifestyle management, genetics, epigenetics, therapeutic approaches, and the prospective trajectory of MASLD, particularly exploring its connection with organoids.

HTT
Also flagged:Postpartum PsychosisparturitionPostpartummental disorderspostpartum depressionpsychosis
Journal Article 2024-02-08 ✓ 5 Snippets Tsokkou S, Kavvadas D, Georgaki MN, Papadopoulou K, Papamitsou T, Karachrysafi S.
In-Text Gene Mentions

First, a number of genes are associated with depressive disorders, such as variations in the 5-HTT serotonin transporter gene and polymorphisms in the STin2.12 allele [8]; SNPs [9]; clock-controlled genes (CCGs) driven by endogenous molecular clocks that regulate rhythmic expression [31]; SLC6A4, COMT, TPH2, FKBP5, MDD1, HTR2A, and MDD2 as well as methylation in genes BDNF, NR3C1, and OXTR [30]; the CCN gene family with elevated CCN2 and CCN3 expression [28]; deletion of the STS gene [27]; methyl transferase-like 13; chromosomal locations 16p13 and 8q24 [8]; mRNA expression of 5α-reductase type I [25], and PRS folate metabolism (MTHFR C677T) [20].

…variations in the5-HTT serotonin transporterserotonin transporter gene…

…The5-HTT serotonin transporterserotonin transporter gene,…

…Variations in the5-HTT Serotonin TransporterSerotonin Transporter Gene…

…studies reported that5-HTTserotonin transporter gene…

Show Full Abstract

<b>Purpose:</b> Postpartum psychosis (PPP) is a serious mental health illness affecting women post-parturition. Around 1 in 1000 women are affected by postpartum psychosis, and the symptoms usually appear within 2 weeks after birth. Postpartum mental disorders are classified into 3 main categories starting from the least to most severe types, including baby blues, postpartum depression, and postpartum psychosis. <b>Materials and Methods:</b> In this systematic review, genetic and epigenetic factors associated with postpartum psychosis are discussed. A PRISMA flow diagram was followed, and the following databases were used as main sources: PubMed, ScienceDirect, and Scopus. Additional information was retrieved from external sources and organizations. The time period for the articles extracted was 5 years. <b>Results:</b> Initially, a total of 2379 articled were found. After the stated criteria were applied, 58 articles were identified along with 20 articles from additional sources, which were then narrowed down to a final total of 29 articles. <b>Conclusions:</b> It can be concluded that there is an association between PPP and genetic and epigenetic risk factors. However, based on the data retrieved and examined, the association was found to be greater for genetic factors. Additionally, the presence of bipolar disorder and disruption of the circadian cycle played a crucial role in the development of PPP.

ABT1
Also flagged:EndometriosisMMP-2MMP-9TGF-β1dienogestMMP2
Journal Article 2024-02-08 ✓ 1 Snippet Jianu EM, Pop RM, Gherman LM, Ranga F, Levai AM, Rus V, Bolboacă SD, Ștefan RA, Onofrei MM, Nati ID, Stoia IA, Ștefan PA, Mihu C, Mihu CM.
In-Text Gene Mentions

…transducer, and theactivator of transcription 1of transcription 1/3…

Show Full Abstract

Endometriosis is a common gynecological condition with a complex physio-pathological background. This study aimed to assess the role of <i>Rubus idaeus</i> leaf extract (RiDE) as a potential therapeutic agent in reducing the size of the endometriotic lesions and modulate the plasma expression of MMP-2, MMP-9, and TGF-β1. The endometriotic lesions were induced in a rat model by the autologous transplant of endometrium. Thirty-six female rats, Wistar breed, with induced endometriosis, were divided into four groups and underwent treatment for 28 days. The CTRL group received 0.5 mL/day of the vehicle; the DG group received 1 mg/kg b.w./day dienogest; the RiDG group received 0.25 mL/kg b.w./day RiDE and the D+RiDG group received 1 mg/kg b.w./day dienogest and 0.25 mL/kg b.w./day RiDE, respectively. Rats' weight, endometriotic lesion diameter and grade, and plasma levels of MMP-2, MMP-9, and TGF-β1 were assessed before and after treatment. The administration of RiDE in association with dienogest vs. dienogest determined a lower weight gain and a reduction in diameter of the endometriotic lesions. RiDE administration restored MMP2 and MMP9 plasma levels to initial conditions. <i>Rubus idaeus</i> extract may help in reducing dienogest-associated weight gain, lower the size of endometriotic lesions, and have anti-inflammatory effects through MMP2 and MMP9 reduction.

bioRxiv 2024-02-08 Preprint (No Snippets API) Sanchís-Calleja F, Jain A, He Z, Okamoto R, Rusimbi C, Rifes P, Rathore GS, Santel M, Janssens J, Seimiya M, Fleck JS, Kirkeby A, Camp JG, Treutlein B.
Show Full Abstract

Morphogens, secreted signalling molecules that direct cell fate and tissue development, are used to direct neuroepithelial progenitors towards discrete regional identities across the central nervous system. Neural tissues derived from pluripotent stem cells in vitro (neural organoids) provide new models for studying neural regionalization, however, we lack a comprehensive survey of how the developing human neuroepithelium responds to morphogen cues. Here, we produce a detailed map of morphogen-induced effects on the axial and regional specification of human neural organoids using a multiplexed single-cell transcriptomics screen. We find that the timing, concentration, and combination of morphogens strongly influence organoid cell type and regional composition, and that cell line and neural induction method strongly impact the response to a given morphogen condition. We apply concentration gradients in microfluidic chips or a range of static concentrations in multi-well plates to explore how human neuroepithelium interprets morphogen concentrations and observe similar dose-dependent induction of patterned domains in both scenarios. Altogether, we provide a detailed resource that supports the development of new regionalized neural organoid protocols and enhances our understanding of human central nervous system patterning.

bioRxiv 2024-02-08 Preprint (No Snippets API) Yadav M, Harding RJ, Li T, Xu X, Gall-Duncan T, Khan M, Bardile CF, Sequiera GL, Duan S, Chandrasekaran R, Pan A, Bu J, Yamazaki T, Hirose T, Prinos P, Tippett L, Turner C, Curtis MA, Faull RL, Pouladi MA, Pearson CE, He HH, Arrowsmith CH.
Show Full Abstract

<h4> Abstract </h4> Huntingtin protein, mutated in Huntington disease, is implicated in nucleic acid- mediated processes, yet evidence for direct huntingtin-nucleic acid interaction is limited. Here we show wildtype and mutant huntingtin co-purify with nucleic acids, primarily RNA, and interact directly with G-rich RNAs in in vitro assays. Huntingtin RNA immunoprecipitation sequencing from patient-derived fibroblasts and neuronal progenitor cells expressing wildtype and mutant huntingtin revealed NEAT1 as a significantly enriched transcript. Altered NEAT1 levels were evident in Huntington’s disease cells and postmortem brain tissues, and huntingtin knockdown decreased NEAT1 levels. Huntingtin co-localized with NEAT1 in paraspeckles, and we identified a high-affinity RNA motif preferred by huntingtin. This study highlights NEAT1 as a novel huntingtin interactor, demonstrating huntingtin’s involvement in RNA-mediated functions and paraspeckle regulation. <h4>One-Sentence Summary</h4> HTT is an RNA-binding protein that interacts with G-rich sequences, including those in the paraspeckle lncRNA NEAT1.

Preprints.org 2024-02-08 Preprint (No Snippets API) Obed Fernando I, Shin S, Zirek D.
Show Full Abstract

The primary objective of this study is to examine the extent of financial integration between Latin American and US financial markets, particularly in light of recent efforts to foster integration through trade agreements. Spanning from January 1, 1990, to December 31, 2019, the sample focuses on major market indices and key sectors. Financial integration is quantified using a DCC multivariate GARCH model, incorporating a smooth transition model, structural breaks, and regression-based approaches. Results indicate increased comovement with the US for main market indices in Argentina, Chile, Colombia, Mexico, and Peru, while Brazil shows a decrease. Similar trends are observed in sectoral analyses. The study also reveals heightened correlation post-trade agreements. Structural break analysis highlights significant shifts in dynamic correlations for countries with US free trade agreements. These findings support the argument of increased financial integration, bearing significance for portfolio diversification and international policy formulation.

bioRxiv 2024-02-08 Preprint (No Snippets API) Ghazi PC, O’Toole KT, Srinivas Boggaram S, Scherzer MT, Silvis MR, Zhang Y, Bogdan M, Smith BD, Lozano G, Flynn DL, Snyder EL, Kinsey CG, McMahon M.
Show Full Abstract

<h4>ABSTRACT</h4> Mutational activation of KRAS occurs commonly in lung carcinogenesis and, with the recent FDA approval of covalent inhibitors of KRAS G12C such as sotorasib or adagrasib, KRAS oncoproteins are important pharmacological targets in non-small cell lung cancer (NSCLC). However, not all KRAS G12C -driven NSCLCs respond to these inhibitors, and the emergence of drug resistance in those patients that do respond can be rapid and pleiotropic. Hence, based on a backbone of covalent inhibition of KRAS G12C , efforts are underway to develop effective combination therapies. Here we report that inhibition of KRAS G12C signaling increases autophagy in KRAS G12C expressing lung cancer cells. Moreover, the combination of DCC-3116, a selective ULK1/2 inhibitor, plus sotorasib displays cooperative/synergistic suppression of human KRAS G12C -driven lung cancer cell proliferation in vitro and superior tumor control in vivo . Additionally, in genetically engineered mouse models of KRAS G12C -driven NSCLC, inhibition of either KRAS G12C or ULK1/2 decreases tumor burden and increases mouse survival. Consequently, these data suggest that ULK1/2-mediated autophagy is a pharmacologically actionable cytoprotective stress response to inhibition of KRAS G12C in lung cancer.

RABGAP1L
Also flagged:type 2 diabetessubstance use disorderNucleotideChromosomeChromosomesmitochondria
Journal Article 2024-02-07 ✓ 1 Snippet Ball RL, Bogue MA, Liang H, Srivastava A, Ashbrook DG, Lamoureux A, Gerring MW, Hatoum AS, Kim MJ, He H, Emerson J, Berger AK, Walton DO, Sheppard K, El Kassaby B, Castellanos F, Kunde-Ramamoorthy G, Lu L, Bluis J, Desai S, Sundberg BA, Peltz G, Fang Z, Churchill GA, Williams RW, Agrawal A, Bult CJ, Philip VM, Chesler EJ.
In-Text Gene Mentions

…and TNN ,RABGAP1L, DNM3 ,…

Show Full Abstract

Hundreds of inbred mouse strains and intercross populations have been used to characterize the function of genetic variants that contribute to disease. Thousands of disease-relevant traits have been characterized in mice and made publicly available. New strains and populations including consomics, the collaborative cross, expanded BXD, and inbred wild-derived strains add to existing complex disease mouse models, mapping populations, and sensitized backgrounds for engineered mutations. The genome sequences of inbred strains, along with dense genotypes from others, enable integrated analysis of trait-variant associations across populations, but these analyses are hampered by the sparsity of genotypes available. Moreover, the data are not readily interoperable with other resources. To address these limitations, we created a uniformly dense variant resource by harmonizing multiple data sets. Missing genotypes were imputed using the Viterbi algorithm with a data-driven technique that incorporates local phylogenetic information, an approach that is extendable to other model organisms. The result is a web- and programmatically accessible data service called GenomeMUSter, comprising single-nucleotide variants covering 657 strains at 106.8 million segregating sites. Interoperation with phenotype databases, analytic tools, and other resources enable a wealth of applications, including multitrait, multipopulation meta-analysis. We show this in cross-species comparisons of type 2 diabetes and substance use disorder meta-analyses, leveraging mouse data to characterize the likely role of human variant effects in disease. Other applications include refinement of mapped loci and prioritization of strain backgrounds for disease modeling to further unlock extant mouse diversity for genetic and genomic studies in health and disease.

SOX6
Also flagged:MBOAT2SLC25A21experimental autoimmune encephalomyelitisNicotinamide adenine dinucleotidemultiple sclerosisMS
Journal Article 2024-02-07 ✓ 5 Snippets Zeng X, Zhang K, Liang M, Yu B, Zhang P, Mehmood A, Zhang H.
In-Text Gene Mentions

DEGs (<i>MBOAT2</i>, <i>SLC25A21</i>, and <i>SOX6</i>) between the EAE and the EAE + NAD<sup>+</sup> groups showed that <i>SOX6</i> was significantly improved after NAD<sup>+</sup> treatment compared with the EAE group, and other indicators were improved but did not reach statistical significance.

NAD<sup>+</sup> affects differentially expressed genes-<i>MBOAT2</i>-<i>SLC25A21</i>-<i>SOX6</i> in experimental autoimmune encephalomyelitis model.

…t;SLC25A21&lt;/i&gt;-&lt;i&gt;SOX6&lt;/i&gt; in experimental aut…

…</i>, <i>SLC25A21</i>, and <i>SOX6</i>) between the EAE…

…groups showed that <i>SOX6</i> was significantly improve…

Show Full Abstract

<h4>Background</h4>Nicotinamide adenine dinucleotide (NAD<sup>+</sup>) plays a key role in neuroinflammation and neurodegeneration and provides anti-inflammatory and neuroprotective effects in multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE).<h4>Aim</h4>In this study, we aimed to investigate whether NAD<sup>+</sup> affects differentially expressed genes (DEGs) in splenocytes of EAE mice to reveal candidate genes for the pathogenesis of MS.<h4>Methods</h4>The EAE model was used to perform an intervention on NAD<sup>+</sup> to investigate its potential as a protective agent in inflammation and demyelination. Transcriptome analysis of nerve tissue was carried out to gain better insights into NAD<sup>+</sup> function. Effects of NAD<sup>+</sup> on DEGs in the splenocytes of EAE mice were investigated to determine its anti-inflammatory effect.<h4>Results</h4>NAD<sup>+</sup> in EAE mice showed the clinical score was significantly improved (EAE 3.190 ± 0.473 vs. NAD<sup>+</sup> 2.049 ± 0.715). DEGs (<i>MBOAT2</i>, <i>SLC25A21</i>, and <i>SOX6</i>) between the EAE and the EAE + NAD<sup>+</sup> groups showed that <i>SOX6</i> was significantly improved after NAD<sup>+</sup> treatment compared with the EAE group, and other indicators were improved but did not reach statistical significance. NAD<sup>+</sup> exhibited clinical scores in EAE mice, and key inflammation was ameliorated in EAE mice spleen after NAD<sup>+</sup> intervention, while transcriptome analysis between EAE and EAE + NAD<sup>+</sup> groups showed several DEGs in the underlying mechanism.<h4>Conclusion</h4>NAD<sup>+</sup> on DEGs attenuates disease severity in EAE. Transcriptome analysis on nerve tissue reveals several protein targets in the underlying mechanisms. However, NAD<sup>+</sup> does not significantly improve DEGs in the splenocytes of the EAE model.

HTT
Also flagged:histoneneurodegenerative disordersmethylationmodificationsgene expressionresponse to stress
Journal Article 2024-02-07 ✓ 1 Snippet Basavarajappa BS, Subbanna S.
In-Text Gene Mentions

HTT

Show Full Abstract

Recent genomics and epigenetic advances have empowered the exploration of DNA/RNA methylation and histone modifications crucial for gene expression in response to stress, aging and disease. Interest in understanding neuronal plasticity's epigenetic mechanisms, influencing brain rewiring amid development, aging and neurodegenerative disorders, continues to grow. Histone acetylation dysregulation, a commonality in diverse brain disorders, has become a therapeutic focus. Histone acetyltransferases and histone deacetylases have emerged as promising targets for neurodegenerative disorder treatment. This review delves into histone acetylation regulation, potential therapies and future perspectives for disorders like Alzheimer's, Parkinson's and Huntington's. Exploring genetic-environmental interplay through models and studies reveals molecular changes, behavioral insights and early intervention possibilities targeting the epigenome in at-risk individuals.

DARS2
Also flagged:Ponatinibcontractile failuremitochondrialtyrosine kinasechronic myeloid leukemiaGCN2
Journal Article 2024-02-07 ✓ 1 Snippet Yan G, Han Z, Kwon Y, Jousma J, Nukala SB, Prosser BL, Du X, Pinho S, Ong SB, Lee WH, Ong SG.
In-Text Gene Mentions

DARS2

Show Full Abstract

<h4>Background</h4>Mitochondrial dysfunction is a primary driver of cardiac contractile failure; yet, the cross talk between mitochondrial energetics and signaling regulation remains obscure. Ponatinib, a tyrosine kinase inhibitor used to treat chronic myeloid leukemia, is among the most cardiotoxic tyrosine kinase inhibitors and causes mitochondrial dysfunction. Whether ponatinib-induced mitochondrial dysfunction triggers the integrated stress response (ISR) to induce ponatinib-induced cardiotoxicity remains to be determined.<h4>Methods</h4>Using human induced pluripotent stem cells-derived cardiomyocytes and a recently developed mouse model of ponatinib-induced cardiotoxicity, we performed proteomic analysis, molecular and biochemical assays to investigate the relationship between ponatinib-induced mitochondrial stress and ISR and their role in promoting ponatinib-induced cardiotoxicity.<h4>Results</h4>Proteomic analysis revealed that ponatinib activated the ISR in cardiac cells. We identified GCN2 (general control nonderepressible 2) as the eIF2α (eukaryotic translation initiation factor 2α) kinase responsible for relaying mitochondrial stress signals to trigger the primary ISR effector-ATF4 (activating transcription factor 4), upon ponatinib exposure. Mechanistically, ponatinib treatment exerted inhibitory effects on ATP synthase activity and reduced its expression levels resulting in ATP deficits. Perturbed mitochondrial function resulting in ATP deficits then acts as a trigger of GCN2-mediated ISR activation, effects that were negated by nicotinamide mononucleotide, an NAD<sup>+</sup> precursor, supplementation. Genetic inhibition of ATP synthase also activated GCN2. Interestingly, we showed that the decreased abundance of ATP also facilitated direct binding of ponatinib to GCN2, unexpectedly causing its activation most likely because of a conformational change in its structure. Importantly, administering an ISR inhibitor protected human induced pluripotent stem cell-derived cardiomyocytes against ponatinib. Ponatinib-treated mice also exhibited reduced cardiac function, effects that were attenuated upon systemic ISRIB administration. Importantly, ISRIB does not affect the antitumor effects of ponatinib in vitro.<h4>Conclusions</h4>Neutralizing ISR hyperactivation could prevent or reverse ponatinib-induced cardiotoxicity. The findings that compromised ATP production potentiates GCN2-mediated ISR activation have broad implications across various cardiac diseases. Our results also highlight an unanticipated role of ponatinib in causing direct activation of a kinase target despite its role as an ATP-competitive kinase inhibitor.

ZNFX1
Also flagged:white spot syndrome virus infectionimmune responsemicrobial infectionsvirionsantiviral responseviral infection
Journal Article 2024-02-07 ✓ 1 Snippet Cui C, Tang X, Xing J, Sheng X, Chi H, Zhan W.
In-Text Gene Mentions

ZNFX1

Show Full Abstract

Shrimp hemocytes are the vital immune cells participating in innate immune response to defend against viruses. However, the lack of specific molecular markers for shrimp hemocyte hindered the insightful understanding of their functional clusters and differential roles in combating microbial infections. In this study, we used single-cell RNA sequencing to map the transcriptomic landscape of hemocytes from the white spot syndrome virus (WSSV)-infected <i>Litopenaeus vannamei</i> and conjointly analyzed with our previous published single-cell RNA sequencing technology data from the healthy hemocytes. A total of 16 transcriptionally distinct cell clusters were identified, which occupied different proportions in healthy and WSSV-infected hemocytes and exerted differential roles in antiviral immune response. Following mapping of the sequencing data to the WSSV genome, we found that all types of hemocytes could be invaded by WSSV virions, especially the cluster 8, which showed the highest transcriptional levels of WSSV genes and exhibited a cell type-specific antiviral response to the viral infection. Further evaluation of the cell clusters revealed the delicate dynamic balance between hemocyte immune response and viral infestation. Unsupervised pseudo-time analysis of hemocytes showed that the hemocytes in immune-resting state could be significantly activated upon WSSV infection and then functionally differentiated to different hemocyte subsets. Collectively, our results revealed the differential responses of shrimp hemocytes and the process of immune-functional differentiation post-WSSV infection, providing essential resource for the systematic insight into the synergistic immune response mechanism against viral infection among hemocyte subtypes.<h4>Importance</h4>Current knowledge of shrimp hemocyte classification mainly comes from morphology, which hinder in-depth characterization of cell lineage development, functional differentiation, and different immune response of hemocyte types during pathogenic infections. Here, single-cell RNA sequencing was used for mapping hemocytes during white spot syndrome virus (WSSV) infection in <i>Litopenaeus vannamei</i>, identifying 16 cell clusters and evaluating their potential antiviral functional characteristics. We have described the dynamic balance between viral infestation and hemocyte immunity. And the functional differentiation of hemocytes under WSSV stimulation was further characterized. Our results provided a comprehensive transcriptional landscape and revealed the heterogeneous immune response in shrimp hemocytes during WSSV infection.

H4C8
Also flagged:chronic periodontitisatherosclerosisbiofilm formationperiodontitispolymicrobial diseaseimmune responses
Journal Article 2024-02-07 ✓ 1 Snippet Irfan M, Solbiati J, Duran-Pinedo A, Rocha FG, Gibson FC, Frias-Lopez J.
In-Text Gene Mentions

…In particular, genesH4C8and H4C9, both synthesizing histones, were upregulated in the wild type compared to the mutant.…

Show Full Abstract

The ability of many human pathogens to infect requires their ability to adhere to the host surfaces as a first step in the process. <i>Porphyromonas gingivalis,</i> a keystone oral pathogen<i>,</i> uses adhesins to adhere to the surface of the gingival epithelium and other members of the oral microbiome. In a previous study, we identified several proteins potentially linked to virulence whose mRNA levels are regulated by CRISPR-Cas type I-C. Among those, PGN_1547 was highly upregulated in the CRISPR-Cas 3 mutant. PGN_1547 is annotated as a hypothetical protein. Employing homology searching, our data support that PGN_1547 resembles an auto-transporter adhesin of <i>P. gingivalis</i> based on containing the DUF2807 domain. To begin to characterize the function of PGN_1547, we found that a deletion mutant displayed a significant decrease in virulence using a <i>Galleria mellonela</i> model. Furthermore, this mutant was significantly impaired in forming biofilms and attaching to the macrophage-like cell THP-1. Luminex revealed that the PGN_1547 mutant elicited a less robust cytokine and chemokine response from THP-1 cells, and TLR2 predominantly sensed that recombinant PGN_1547. Taken together, these findings broaden our understanding of the toolbox of virulence factors possessed by <i>P. gingivalis</i>. Importantly, PGN_1547, a hypothetical protein, has homologs in another member of the order Bacteroidales whose function is unknown, and our results could shed light on the role of this family of proteins as auto-transport adhesins in this phylogenetic group.IMPORTANCEPeriodontal diseases are among humans' most common infections, and besides their effect on the oral cavity, they have been associated with systemic inflammatory conditions. Among members of the oral microbiome implicated in the development of periodontitis, <i>Porphyromonas gingivalis</i> is considered a keystone pathogen. We have identified a new adhesin that acts as a virulence factor, PGN_1547, which contains the DUF2807 domain, which belongs to the putative auto-transporter adhesin, head GIN domain family. Deletion of this gene lowers the virulence of <i>P</i>. <i>gingivalis</i> and impacts the ability of <i>P</i>. <i>gingivalis</i> to form biofilm and attach to host cells. Furthermore, the broad distribution of these receptors in the order Bacteroidales suggests their importance in colonization by this important group of organisms.

HTT
Also flagged:HTR1BSLC18A2amino acidneurotransmitter receptorsdopamineserotonin receptors
Journal Article 2024-02-07 ✓ 2 Snippets Ruiz-De-La-Cruz G, Sifuentes-Rincón AM, Paredes-Sánchez FA, Parra-Bracamonte GM, Casas E, Riley DG, Perry GA, Welsh TH, Randel RD.
In-Text Gene Mentions

…D3 (DRD3), huntingtin (HTT), proopiomelanocortin (POMC),…

…As for theHTTgene, we referenced…

Show Full Abstract

<h4>Background</h4>Temperament is an important production trait in cattle and multiple strategies had been developed to generate molecular markers to assist animal selection. As nonsynonymous single nucleotide polymorphisms are markers with the potential to affect gene functions, they could be useful to predict phenotypic effects. Genetic selection of less stress-responsive, temperamental animals is desirable from an economic and welfare point of view.<h4>Methods and results</h4>Two nonsynonymous single nucleotide polymorphisms identified in HTR1B and SLC18A2 candidate genes for temperament were analyzed in silico to determine their effects on protein structure. Those nsSNPs allowing changes in proteins were selected for a temperament association analysis in a Brahman population. Transversion effects on protein structure were evaluated in silico for each amino acid change model, revealing structural changes in the proteins of the HTR1B and SLC18A2 genes. The selected nsSNPs were genotyped in a Brahman population (n = 138), and their genotypic effects on three temperament traits were analyzed: exit velocity, pen score, and temperament score. Only the SNP rs209984404-HTR1B (C/A) showed a significant association (P = 0.0144) with pen score. The heterozygous genotype showed a pen score value 1.17 points lower than that of the homozygous CC genotype.<h4>Conclusion</h4>The results showed that in silico analysis could direct the selection of nsSNPs with the potential to change the protein. Non-synonymous single nucleotide polymorphisms causing structural changes and reduced protein stability were identified. Only rs209984404-HTR1B shows that the allele affecting protein stability was associated with the genotype linked to docility in cattle.

SERPINC1
Also flagged:SepsisinfectionanemiaheparincoagulopathyAPC
Journal Article 2024-02-07 ✓ 5 Snippets Williams B, Zou L, Pittet JF, Chao W.
In-Text Gene Mentions

…alpha activated], TFPI,ATIII, and TM), but…

…or ART-123) andATIIIsupplementation is also…

…randomized trial ofATIIIsupplementation in 42…

…the effects ofATIIIin septic patients…

…neither rhTM norATIIIis currently approved…

Show Full Abstract

Physiological hemostasis is a balance between pro- and anticoagulant pathways, and in sepsis, this equilibrium is disturbed, resulting in systemic thrombin generation, impaired anticoagulant activity, and suppression of fibrinolysis, a condition termed sepsis-induced coagulopathy (SIC). SIC is a common complication, being present in 24% of patients with sepsis and 66% of patients with septic shock, and is often associated with poor clinical outcomes and high mortality. 1 , 2 Recent preclinical and clinical studies have generated new insights into the molecular pathogenesis of SIC. In this article, we analyze the complex pathophysiology of SIC with a focus on the role of procoagulant innate immune signaling in hemostatic activation--tissue factor production, thrombin generation, endotheliopathy, and impaired antithrombotic functions. We also review clinical presentations of SIC, the diagnostic scoring system and laboratory tests, the current standard of care, and clinical trials evaluating the efficacies of anticoagulant therapies.

Also flagged:gastrointestinal disordersirritable bowel syndromegastroesophageal refluxpeptic ulcersirritable bowel diseasenecrotizing enterocolitis
Journal Article 2024-02-07 No Snippets Oviedo-León JF, Cornejo-Mazón M, Ortiz-Hernández R, Torres-Ramírez N, Hernández-Sánchez H, Castro-Rodríguez DC.
Show Full Abstract

Due to the distinctive characteristics of probiotics, it is essential to pinpoint strains originating from diverse sources that prove efficacious in addressing a range of pathologies linked to dysfunction of the intestinal barrier. Nine strains of lactic acid bacteria were isolated from two different sources of tepache kefir grains (KAS2, KAS3, KAS4, KAS7, KAL4, KBS2, KBS3, KBL1 and KBL3), and were categorized to the genus Lacticaseibacillus, Liquorilactobacillus, and Lentilactobacillus by 16S rRNA gene. Kinetic behaviors of these strains were evaluated in MRS medium, and their probiotic potential was performed: resistance to low pH, tolerance to pepsin, pancreatin, bile salts, antibiotic resistance, hemolytic activity, and adhesion ability. KAS7 strain presented a higher growth rate (0.50 h-1) compared with KAS2 strain, who presented a lower growth rate (0.29 h-1). KBS2 strain was the only strain that survived the in vitro stomach simulation conditions (29.3%). Strain KBL1 demonstrated significantly higher viability (90.6%) in the in vitro intestine simulation conditions. Strain KAS2 demonstrated strong hydrophilic character with chloroform (85.6%) and xylol (57.6%) and a higher percentage of mucin adhesion (87.1%). However, strains KBS2 (84.8%) and KBL3 (89.5%) showed the highest autoaggregation values. In terms of adhesion to the intestinal epithelium in rats, strains KAS2, KAS3 and KAS4 showed values above 80%. The growth of the strains KAS2, KAS3, KAS4, KBS2, and KBL3 was inhibited by cefuroxime, cefotaxime, tetracycline, ampicillin, erythromycin, and cephalothin. Strains KBS2 (41.9% and 33.5%) and KBL3 (42.5% and 32.8%) had the highest co-aggregation values with S. aureus and E. coli. The results obtained in this study indicate that lactic acid bacteria isolated from tepache can be considered as candidates for potentially probiotic bacteria, laying the foundations to evaluate their probiotic functionality in vivo and thus to be used in the formulation of functional foods.

SOX6
Also flagged:Myelinationaction potentialsaxonsneurological disordersleukodystrophygenetic disorder
Journal Article 2024-02-07 ✓ 1 Snippet Li Y, Wan LP, Song NN, Ding YQ, Zhao S, Niu J, Mao B, Sheng N, Ma P.
In-Text Gene Mentions

…Id2, Id4, Sox5,Sox6, and Ascl1 (…

Show Full Abstract

Maldevelopment of oligodendroglia underlies neural developmental disorders such as leukodystrophy. Precise regulation of the activity of specific transcription factors (TFs) by various posttranslational modifications (PTMs) is required to ensure proper oligodendroglial development and myelination. However, the role of ubiquitination of these TFs during oligodendroglial development is yet unexplored. Here, we find that RNF220, a known leukodystrophy-related E3 ubiquitin ligase, is required for oligodendroglial development. RNF220 depletion in oligodendrocyte lineage cells impedes oligodendrocyte progenitor cell proliferation, differentiation, and (re)myelination, which consequently leads to learning and memory defects. Mechanistically, RNF220 targets Olig1/2 for K63-linked polyubiquitination and stabilization during oligodendroglial development. Furthermore, in a knock-in mouse model of leukodystrophy-related RNF220<sup>R365Q</sup> mutation, the ubiquitination and stabilization of Olig proteins are deregulated in oligodendroglial cells. This results in pathomimetic oligodendroglial developmental defects, impaired myelination, and abnormal behaviors. Together, our evidence provides an alternative insight into PTMs of oligodendroglial TFs and how this essential process may be implicated in the etiology of leukodystrophy.

Also flagged:carboxylic acidsestersalkylaldehydesalcoholssynthesis
Journal Article 2024-02-07 No Snippets Gao Y, Jiang B, Friede NC, Hunter AC, Boucher DG, Minteer SD, Sigman MS, Reisman SE, Baran PS.
Show Full Abstract

The first general enantioselective alkyl-Nozaki-Hiyama-Kishi (NHK) coupling reactions are disclosed herein by employing a Cr-electrocatalytic decarboxylative approach. Using easily accessible aliphatic carboxylic acids (via redox-active esters) as alkyl nucleophile synthons, in combination with aldehydes and enabling additives, chiral secondary alcohols are produced in a good yield with high enantioselectivity under mild reductive electrolysis. This reaction, which cannot be mimicked using stoichiometric metal or organic reductants, tolerates a broad range of functional groups and is successfully applied to dramatically simplify the synthesis of multiple medicinally relevant structures and natural products. Mechanistic studies revealed that this asymmetric alkyl e-NHK reaction was enabled by using catalytic tetrakis(dimethylamino)ethylene, which acts as a key reductive mediator to mediate the electroreduction of the Cr<sup>III</sup>/chiral ligand complex.

Also flagged:catecholsboronatetribenzotriquinacenesphenylene diboronic acidsboronwater
Journal Article 2024-02-07 No Snippets Kirchner PH, Schramm L, Ivanova S, Shoyama K, Würthner F, Beuerle F.
Show Full Abstract

The reversible condensation of catechols and boronic acids to boronate esters is a paradigm reaction in dynamic covalent chemistry. However, facile backward hydrolysis is detrimental for stability and has so far prevented applications for boronate-based materials. Here, we introduce cubic boronate ester cages <b>6</b> derived from hexahydroxy tribenzotriquinacenes and phenylene diboronic acids with <i>ortho</i>-<i>t</i>-butyl substituents. Due to steric shielding, dynamic exchange at the Lewis acidic boron sites is feasible only under acid or base catalysis but fully prevented at neutral conditions. For the first time, boronate ester cages <b>6</b> tolerate substantial amounts of water or alcohols both in solution and solid state. The unprecedented applicability of these materials under ambient and aqueous conditions is showcased by efficient encapsulation and on-demand release of β-carotene dyes and heterogeneous water oxidation catalysis after the encapsulation of ruthenium catalysts.

HTT
Also flagged:escitalopramserotonincognitionresponse to threatMajor Depressive Disorderbehavioural
Journal Article 2024-02-07 ✓ 2 Snippets Armand S, Langley C, Johansen A, Ozenne B, Overgaard-Hansen O, Larsen K, Jensen PS, Knudsen GM, Sahakian BJ, Stenbæk DS, Fisher PM.
In-Text Gene Mentions

…The 5-HT transporter (5-HTT) is a protein…

…The5-HTTis the main…

Show Full Abstract

Short-term intake of selective serotonin reuptake inhibitors (SSRIs) modulates threat-related amygdala responses in healthy individuals. However, how SSRI intake over a clinically relevant time period modulates threat-related amygdala responses is less clear. In a semi-randomised, double-blind, placebo-controlled study of 64 healthy individuals (SSRI n = 32, placebo n = 32), we examined the effect of 3-5 weeks of SSRI escitalopram (20 mg daily) on brain response to angry, fearful and neutral faces using BOLD fMRI. Data was analysed using a whole-brain region-wise approach extracting standardised effects (i.e., Cohen's D). The study was conducted at the Copenhagen University Hospital. A priori, we hypothesised that SSRI would attenuate amygdala responses to angry and fearful faces but not to neutral ones. Whether SSRI modulates correlations between amygdala responses to emotional faces and negative mood states was also explored. Compared to placebo, 3-5 weeks of SSRI intake did not significantly affect the amygdala response to angry, fearful, or neutral faces (|Cohen's D|< 0.2, P<sub>FWER</sub> = 1). Whole-brain, region-wise analyses revealed significant differences in frontal (|Cohen's D|< 0.6, P<sub>FWER</sub> < .01) and occipital regions (|Cohen's D|< 0.5, P<sub>FWER</sub> < .01). SSRI did not modulate correlations between amygdala responses to emotional faces and negative mood states. Our findings indicate that a 3-5 week SSRI intake impacts cortical responses to emotional stimuli, an effect possibly involved in SSRI's therapeutic efficacy.Trial registration Clinical Trials NCT04239339.

TNFSF4
Also flagged:cancerCRHBPtumorCorticotropin-releasing hormone-binding proteinGene Expressioncancers
Journal Article 2024-02-07 ✓ 1 Snippet Chen B, Chen S, Wang X, Zhang J, Wang H, Li J, Zhang Z, Yu F, Kong W.
In-Text Gene Mentions

…CD28, CD200R1, CD200,TNFSF4, CD244, LAG3, NRP1,…

Show Full Abstract

Corticotropin-releasing hormone-binding protein (CRHBP) is involved in many physiological processes. However, it is still unclear what role CRHBP has in tumor immunity and prognosis prediction. Using databases such as the Cancer Genome Atlas (TCGA), Gene Expression Omnibus (GEO), Tumor Protein Database, Timer Database, and Gene Expression Profiling Interactive Analysis (GEPIA), we evaluated the potential role of CRHBP in diverse cancers. Further research looked into the relationships between CRHBP and tumor survival prognosis, immune infiltration, immune checkpoint (ICP) indicators, tumor mutation burden (TMB), microsatellite instability (MSI), mismatch repair (MMR), DNA methylation, tumor microenvironment (TME), and drug responsiveness. The anticancer effect of CRHBP in liver hepatocellular carcinoma (LIHC) was shown by Western blotting, EdU staining, JC-1 staining, transwell test, and wound healing assays. CRHBP expression is significantly low in the majority of tumor types and is associated with survival prognosis, ICP markers, TMB, and microsatellite instability (MSI). The expression of CRHBP was found to be substantially related to the quantity of six immune cell types, as well as the interstitial and immunological scores, showing that CRHBP has a substantial impact in the TME. We also noticed a link between the IC50 of a number of anticancer medicines and the degree of CRHBP expression. CRHBP-related signaling pathways were discovered using functional enrichment. Cox regression analysis showed that CRHBP expression was an independent prognostic factor for LIHC. CRHBP has a tumor suppressor function in LIHC, according to cell and molecular biology trials. CRHBP has a significant impact on tumor immunity, treatment, and prognosis, and has the potential as a cancer treatment target and prognostic indicator.

RC3H1
Also flagged:ZFP36cytokinesolid tumorsCas9RNA binding proteinIL2
Journal Article 2024-02-07 ✓ 5 Snippets Mai D, Boyce T, Mehta A, Reff J, Scholler J, Sheppard NC, June CH.
In-Text Gene Mentions

…RBPs include Regnase-1,Roquin-1, and ZFP36 family…

…While Regnase-1 andRoquin-1disruption have now…

…to Regnase-1 orRoquin-1, and that multiplex…

…RBPs Regnase-1 andRoquin-1

…as Regnase-1 andRoquin-1, are crucial in…

Show Full Abstract

Loss of inflammatory effector function, such as cytokine production and proliferation, is a fundamental driver of failure in T cell therapies against solid tumors. Here, we used CRISPR/Cas9 to genetically disrupt ZFP36, an RNA binding protein that regulates the stability of mRNAs involved in T cell inflammatory function, such as the cytokines IL2 and IFNγ, in human T cells engineered with a clinical-stage mesothelin-targeting CAR to determine whether its disruption could enhance antitumor responses. ZFP36 disruption slightly increased antigen-independent activation and cytokine responses but did not enhance overall performance in vitro or in vivo in a xenograft tumor model with NSG mice. While ZFP36 disruption does not reduce the function of CAR-T cells, these results suggest that singular disruption of ZFP36 is not sufficient to improve their function and may benefit from a multiplexed approach.

RC3H1
Also flagged:cancerneoplasmscytokinetumourstumourT
Journal Article 2024-02-07 ✓ 1 Snippet Garcia J, Daniels J, Lee Y, Zhu I, Cheng K, Liu Q, Goodman D, Burnett C, Law C, Thienpont C, Alavi J, Azimi C, Montgomery G, Roybal KT, Choi J.
In-Text Gene Mentions

RC3H1

Show Full Abstract

Adoptive T cell therapies have produced exceptional responses in a subset of patients with cancer. However, therapeutic efficacy can be hindered by poor T cell persistence and function<sup>1</sup>. In human T cell cancers, evolution of the disease positively selects for mutations that improve fitness of T cells in challenging situations analogous to those faced by therapeutic T cells. Therefore, we reasoned that these mutations could be co-opted to improve T cell therapies. Here we systematically screened the effects of 71 mutations from T cell neoplasms on T cell signalling, cytokine production and in vivo persistence in tumours. We identify a gene fusion, CARD11-PIK3R3, found in a CD4<sup>+</sup> cutaneous T cell lymphoma<sup>2</sup>, that augments CARD11-BCL10-MALT1 complex signalling and anti-tumour efficacy of therapeutic T cells in several immunotherapy-refractory models in an antigen-dependent manner. Underscoring its potential to be deployed safely, CARD11-PIK3R3-expressing cells were followed up to 418 days after T cell transfer in vivo without evidence of malignant transformation. Collectively, our results indicate that exploiting naturally occurring mutations represents a promising approach to explore the extremes of T cell biology and discover how solutions derived from evolution of malignant T cells can improve a broad range of T cell therapies.

GPR52
Also flagged:GPR161sterolG protein-coupled receptorGPCRHedgehogextracellular
Journal Article 2024-02-07 ✓ 1 Snippet Hoppe N, Harrison S, Hwang SH, Chen Z, Karelina M, Deshpande I, Suomivuori CM, Palicharla VR, Berry SP, Tschaikner P, Regele D, Covey DF, Stefan E, Marks DS, Reiter JF, Dror RO, Evers AS, Mukhopadhyay S, Manglik A.
In-Text Gene Mentions

GPR52

Show Full Abstract

The orphan G protein-coupled receptor (GPCR) GPR161 plays a central role in development by suppressing Hedgehog signaling. The fundamental basis of how GPR161 is activated remains unclear. Here, we determined a cryogenic-electron microscopy structure of active human GPR161 bound to heterotrimeric G<sub>s</sub>. This structure revealed an extracellular loop 2 that occupies the canonical GPCR orthosteric ligand pocket. Furthermore, a sterol that binds adjacent to transmembrane helices 6 and 7 stabilizes a GPR161 conformation required for G<sub>s</sub> coupling. Mutations that prevent sterol binding to GPR161 suppress G<sub>s</sub>-mediated signaling. These mutants retain the ability to suppress GLI2 transcription factor accumulation in primary cilia, a key function of ciliary GPR161. By contrast, a protein kinase A-binding site in the GPR161 C terminus is critical in suppressing GLI2 ciliary accumulation. Our work highlights how structural features of GPR161 interface with the Hedgehog pathway and sets a foundation to understand the role of GPR161 function in other signaling pathways.

TNFSF4
Also flagged:Senescencetumorscancercell senescencepapillary thyroid carcinomaPTC
Journal Article 2024-02-07 ✓ 2 Snippets Huang Y, Jiang H, Xu G, Li X, Chen W, Lun Y, Zhang J.
In-Text Gene Mentions

Further immune checkpoint and drug sensitivity analysis identified 13 potential immune checkpoints (ADORA2A, TNFSF9, CD274, NRP1, IDO2, CD40, CD28, IDO1, CD160, TNFSF4, CD80, TNFSF15, CD44) and ten sensitive drugs (BX.795, PF.562271, PF.02341066, Pazopanib, PAC.1, MK.2206, IPA.3, Imatinib, GDC0941, Embelin).

…CD28, IDO1, CD160,TNFSF4, CD80, TNFSF15, CD44)…

Show Full Abstract

Senescence-induced therapy was previously considered as an effective treatment for tumors, and cellular senescence was initially regarded as an effective mechanism against cancer. However, whether cell senescence-related genes can be used to predict the prognosis of papillary thyroid carcinoma (PTC) and immunotherapy remains unclear. We developed and validated a cell senescence-related signature (CSRS) by analyzing the gene expression of 278 genes related to cellular senescence in 738 patients with PTC. Additionally, further analysis showed that CSRS was a reliable predictor of patient outcomes in combination with immune checkpoint expression and drug susceptibility, and patients with high risk scores may benefit from immunotherapy. The findings of this study demonstrate that CSRS serves as an immunotherapeutic response and prognosis biomarker affecting the tumor immune microenvironment of PTC.

ZNF322
Also flagged:behavioralethanolchromosomechromosomeswaterRNAse A
Journal Article 2024-02-07 ✓ 1 Snippet Arpin KE, Schmidt DA, Sjodin BMF, Einfeldt AL, Galbreath K, Russello MA.
In-Text Gene Mentions

…transcription factor proteinZNF322.…

Show Full Abstract

Genetic tools for wildlife monitoring can provide valuable information on spatiotemporal population trends and connectivity, particularly in systems experiencing rapid environmental change. Multiplexed targeted amplicon sequencing techniques, such as genotyping-in-thousands by sequencing (GT-seq), can provide cost-effective approaches for collecting genetic data from low-quality and quantity DNA samples, making them potentially useful for long-term wildlife monitoring using non-invasive and archival samples. Here, we developed a GT-seq panel as a potential monitoring tool for the American pika (<i>Ochotona princeps</i>) and evaluated its performance when applied to traditional, non-invasive, and archival samples, respectively. Specifically, we optimized a GT-seq panel (307 single nucleotide polymorphisms (SNPs)) that included neutral, sex-associated, and putatively adaptive SNPs using contemporary tissue samples (<i>n</i> = 77) from the Northern Rocky Mountains lineage of American pikas. The panel demonstrated high genotyping success (94.7%), low genotyping error (0.001%), and excellent performance identifying individuals, sex, relatedness, and population structure. We subsequently applied the GT-seq panel to archival tissue (<i>n</i> = 17) and contemporary fecal pellet samples (<i>n</i> = 129) collected within the Canadian Rocky Mountains to evaluate its effectiveness. Although the panel demonstrated high efficacy with archival tissue samples (90.5% genotyping success, 0.0% genotyping error), this was not the case for the fecal pellet samples (79.7% genotyping success, 28.4% genotyping error) likely due to the exceptionally low quality/quantity of recovered DNA using the approaches implemented. Overall, our study reinforced GT-seq as an effective tool using contemporary and archival tissue samples, providing future opportunities for temporal applications using historical specimens. Our results further highlight the need for additional optimization of sample and genetic data collection techniques prior to broader-scale implementation of a non-invasive genetic monitoring tool for American pikas.

HTT
Also flagged:neurodegenerative disorderneurofilament light chainbrain atrophyTaubreast regression protein 39YKL-40
Journal Article 2024-02-07 ✓ 5 Snippets Bondulich MK, Phillips J, Cañibano-Pico M, Nita IM, Byrne LM, Wild EJ, Bates GP.
In-Text Gene Mentions

To facilitate this, a new evidence-based integrated clinical staging system has been developed that incorporates all available data including biomarkers.25 Within the staging system, imaging biomarkers were chosen to define the process of neurodegeneration and the boundary between stages 0 and 125; however, fluid biomarkers may also aid in the interpretation of this transition.26 Increased levels of neurofilament light chain (NEFL) have been detected in the plasma and CSF of Huntington’s disease patients before the onset of symptoms, and baseline levels have been shown to predict clinical disease status, subsequent clinical progression and brain atrophy.27,28 NEFL is currently the strongest monitoring and prognostic fluid biomarker for Huntington’s disease.28 Other fluid biomarkers that have been reported to correlate with clinical phenotypes of Huntington’s disease include the HTT protein29 total-Tau30 and YKL-40.31

HTT aggregates have been described in the gastrointestinal tract of mouse models of Huntington’s disease,65 and the loss of enteric neuropeptides has been linked to weight loss in these mice.66 Nevertheless, although well-established within the field of dementias, where the functions of Tau are well characterized, it remains mostly speculative in Huntington’s disease and the rate at which changes in brain pathology are reflected in plasma versus CSF total-Tau levels remains to be investigated.

There are currently no approved disease-modifying treatments for Huntington’s disease, but advances in our understanding of its pathogenesis have meant that there are many potential disease-modifying strategies in preclinical and clinical development.23 These include approaches to lower the levels of HTT through the administration of antisense oligonucleotides, RNA interference, zinc finger proteins and small molecules.24 The identification of DNA repair genes as genetic modifiers has induced wide-ranging strategies to target these genes and decrease somatic CAG repeat instability in the brain.23 Irrespective of the approach, it will be important to conduct clinical trials at an early timepoint in the disease, before the onset of observable clinical signs.

Huntington’s disease is a devastating inherited neurodegenerative disorder characterized by motor, cognitive and psychiatric dysfunction.1 It is caused by a CAG triplet repeat expansion within exon 1 of the huntingtin gene (HTT) resulting in an abnormally long polyglutamine tract (polyQ) within the huntingtin protein (HTT).2 Individuals with 35 CAGs or less are unaffected, those with 40 or more will develop the disease within a normal lifespan, and CAG repeats of ∼65 or more will cause disease onset in childhood or adolescence.3 The CAG repeats are unstable on transmission, with expansions generally occurring upon inheritance from a male.4 Expanded repeats are also somatically unstable, with expansions amounting to 100 s of CAGs occurring in specific brain regions.5-8 Although the CAG repeat length in blood correlates with the age of onset and progression of the disease, genetic and environmental factors are also known to contribute.9,10 Recently, genome-wide association studies identified DNA mismatch repair genes as genetic modifiers.11-14 This has led to the widely held hypothesis that somatic CAG repeat expansion is the first step in the Huntington’s disease pathogenesis, as nullizygosity for some of these genes was known to prevent somatic CAG repeat instability in Huntington’s disease mouse models.15,16 The alternative processing of the HTT pre-mRNA, to generate the HTT1a transcript, that encodes the highly aggregation-prone and pathogenic HTTexon1 protein increases with increasing CAG repeat length and is a candidate for the second step in molecular pathogenesis of this disease.17,18 Neuropathologically, the disease is characterized by intranuclear and extranuclear inclusion bodies19,20 and neuronal cell death in the striatum, cortex and other brain regions.21,22

…disease include theHTTprotein 29 total-Tau…

Show Full Abstract

Huntington's disease is an inherited neurodegenerative disorder for which a wide range of disease-modifying therapies are in development and the availability of biomarkers to monitor treatment response is essential for the success of clinical trials. Baseline levels of neurofilament light chain in CSF and plasma have been shown to be effective in predicting clinical disease status, subsequent clinical progression and brain atrophy. The identification of further sensitive prognostic fluid biomarkers is an active research area, and total-Tau and <i>YKL-40</i> levels have been shown to be increased in CSF from Huntington's disease mutation carriers. The use of readouts with clinical utility in the preclinical assessment of potential therapeutics should aid in the translation of new treatments. Here, we set out to determine how the concentrations of these three proteins change in plasma and CSF with disease progression in representative, well-established mouse models of Huntington's disease. Plasma and CSF were collected throughout disease progression from R6/2 transgenic mice with CAG repeats of 200 or 90 codons (R6/2:Q200 and R6/2:Q90), zQ175 knock-in mice and YAC128 transgenic mice, along with their respective wild-type littermates. Neurofilament light chain and total-Tau concentrations were quantified in CSF and plasma using ultrasensitive single-molecule array (Quanterix) assays, and a novel Quanterix assay was developed for breast regression protein 39 (mouse homologue of YKL-40) and used to quantify breast regression protein 39 levels in plasma. CSF levels of neurofilament light chain and plasma levels of neurofilament light chain and breast regression protein 39 increased in wild-type biofluids with age, whereas total-Tau remained constant. Neurofilament light chain and breast regression protein 39 were elevated in the plasma and CSF from Huntington's disease mouse models, as compared with wild-type littermates, at presymptomatic stages, whereas total-Tau was only increased at the latest disease stages analysed. Levels of biomarkers that had been measured in the same CSF or plasma samples taken at the latest stages of disease were correlated. The demonstration that breast regression protein 39 constitutes a robust plasma biomarker in Huntington's disease mouse models supports the further investigation of <i>YKL-40</i> as a CSF biomarker for Huntington's disease mutation carriers. Neurofilament light chain and Tau are considered markers of neuronal damage, and breast regression protein 39 is a marker of inflammation; the similarities and differences in the levels of these proteins between mouse models may provide future insights into their underlying pathology. These data will facilitate the use of fluid biomarkers in the preclinical assessment of therapeutic agents for Huntington's disease, providing readouts with direct relevance to clinical trials.

HTT
Also flagged:Huntington diseaseHDbehavioralneurodegenerative disorderIT15chromosome
Journal Article 2024-02-07 ✓ 5 Snippets Ratz-Wirsching V, Habermeyer J, Moceri S, Harrer J, Schmitz C, von Hörsten S.
In-Text Gene Mentions

Protein level of mutant and physiological HTT were measured via Western Blot analysis with mouse-anti-HTT antibody (Millipore Cat# MAB2166, RRID:AB_2123255, 1:1000) on 7,5% stain free tris-glycine gels (BioRad, Cat# 4568021).

Briefly, this line derives from the Sprague Dawley HD rat model (von Hörsten et al., 2003) and represents a truncated HD model with expression of 727 amino acids (equaling 22%) of the full length Htt gene under the endogenous rat Htt promotor.

…expressing a fragmentedHttconstruct with 51…

…with a truncatedHttconstruct comprising 51…

…the full lengthHttgene under the…

Show Full Abstract

In Huntington disease (HD) the prodromal phase has been increasingly investigated and is currently in focus for early interventional treatments. Also, the influence of sex on disease progression and severity in patients is under discussion, as a sex-specific impact has been reported in transgenic rodent models for HD. To this end, we have been studying these aspects in Sprague Dawley rats transgenic for HD. Here, we took up on the congenic F344tgHD rat model, expressing a fragmented <i>Htt</i> construct with 51 CAG repeats on an inbred F344 rat background and characterized potential sexual dimorphism and gene-dosage effects in rats during the pre-symptomatic phase (1-8 months of age). Our study comprises a longitudinal phenotyping of motor function, emotion and sensorimotor gating, as well as screening of metabolic parameters with classical and automated assays in combination with investigation of molecular HD hallmarks (striatal cell number and volume estimation, appearance of HTT aggregates). Differences between sexes became apparent during middle age, particularly in the motor and sensorimotor domains. Female individuals were generally more active, demonstrated different gait characteristics than males and less anxiolytic-like behavior. Alterations in both the time course and affected behavioral domains varied between male and female F344tgHD rats. First subtle behavioral anomalies were detected in transgenic F344tgHD rats prior to striatal MSN cell loss, revealing a prodromal-like phase in this model. Our findings demonstrate that the congenic F344tgHD rat model shows high face-validity, closely resembling the human disease's temporal progression, while having a relatively low number of CAG repeats, a slowly progressing pathology with a prodromal-like phase and a comparatively subtle phenotype. By differentiating the sexes regarding HD-related changes and characterizing the prodromal-like phase in this model, these findings provide a foundation for future treatment studies.

OLFM4
Also flagged:gene expressionLipoproteincholesterollipoproteinsatherosclerosiscardiovascular diseases
Journal Article 2024-02-07 ✓ 1 Snippet Abbas M, Diallo A, Goodney G, Gaye A.
In-Text Gene Mentions

…3 analyses includesOLFM4, CXCL5, PF4, CAMP,…

Show Full Abstract

<b>Background:</b> GWAS discoveries often pose a significant challenge in terms of understanding their underlying mechanisms. Further research, such as an integration with expression quantitative trait locus (eQTL) analyses, are required to decipher the mechanisms connecting GWAS variants to phenotypes. An eQTL analysis was conducted on genes associated with low-density lipoprotein (LDL) cholesterol and its subclasses, with the aim of pinpointing genetic variants previously implicated in GWAS studies focused on lipid-related traits. Notably, the study cohort consisted of African Americans, a population characterized by a heightened prevalence of hypercholesterolemia. <b>Methods:</b> A comprehensive differential expression (DE) analysis was undertaken, with a dataset of 17,948 protein-coding mRNA transcripts extracted from the whole-blood transcriptomes of 416 samples to identify mRNA transcripts associated with LDL, with further granularity delineated between small LDL and large LDL subclasses. Subsequently, eQTL analysis was conducted with a subset of 242 samples for which whole-genome sequencing data were available to identify single-nucleotide polymorphisms (SNPs) associated with the LDL-related mRNA transcripts. Lastly, plausible functional connections were established between the identified eQTLs and genetic variants reported in the GWAS catalogue. <b>Results:</b> DE analysis revealed 1,048, 284, and 94 mRNA transcripts that exhibited differential expression in response to LDL, small LDL, and large LDL, respectively. The eQTL analysis identified a total of 9,950 significant SNP-mRNA associations involving 6,955 SNPs including a subset 101 SNPs previously documented in GWAS of LDL and LDL-related traits. <b>Conclusion:</b> Through comprehensive differential expression analysis, we identified numerous mRNA transcripts responsive to LDL, small LDL, and large LDL. Subsequent eQTL analysis revealed a rich landscape of eQTL-mRNA associations, including a subset of eQTL reported in GWAS studies of LDL and related traits. The study serves as a testament to the important role of integrative genomics in unraveling the enigmatic GWAS relationships between genetic variants and the complex fabric of human traits and diseases.

Also flagged:Ferroptosisprogrammed cell deathpyroptosisironlipidperoxides
Journal Article 2024-02-07 No Snippets Zhang Y, Xie J.
Show Full Abstract

Ferroptosis, an iron-dependent form of programmed cell death, introduces a novel perspective on cellular demise. This study investigates the regulatory network of exosomal non-coding RNAs (ncRNAs), including miRNAs, circRNAs, and lncRNAs, in ferroptosis modulation. The primary goal is to examine the pathological roles of ferroptosis-related exosomal ncRNAs, particularly in ischemic reperfusion injuries. The research reveals intricate molecular interactions governing the regulatory interplay between exosomal ncRNAs and ferroptosis, elucidating their diverse roles in different non-malignant pathological contexts. Attention is given to their impact on diseases, including cardiac, cerebral, liver, and kidney ischemic injuries, as well as lung, wound, and neuronal injuries. Beyond theoretical exploration, the study provides insights into potential therapeutic applications, emphasizing the significance of mesenchymal stem cells (MSCs)-derived exosomes. Findings underscore the pivotal role of MSC-derived exosomal ncRNAs in modulating cellular responses related to ferroptosis regulation, introducing a cutting-edge dimension. This recognition emphasizes the importance of MSC-derived exosomes as crucial mediators with broad therapeutic implications. Insights unveil promising avenues for targeted interventions, capitalizing on the diverse roles of exosomal ncRNAs, providing a comprehensive foundation for future therapeutic strategies.

RABGAP1L
Also flagged:Migraineprimary neurological disordermigrainesgene expressioncancerpenicillin
Journal Article 2024-02-07 ✓ 3 Snippets Ouyang D, Huang C, Liu H, Xie W, Chen C, Su B, Guo L.
In-Text Gene Mentions

…as CAMTA1, MACF1,RABGAP1L, ZEB2, PHACTR1, REV3L,…

…ANKDD1B, RBM14-RBM4, ASTN2,RABGAP1L, and LRCH1 among…

…SLC24A3, ANKDD1B, RBM14-RBM4,RABGAP1L, and LRCH1—were significantly…

Show Full Abstract

Migraine is a common neurological disorder that affects more than one billion people worldwide. Recent genome-wide association studies have identified 123 genetic loci associated with migraine risk. However, the biological mechanisms underlying migraine and its relationships with other complex diseases remain unclear. We performed a phenome-wide association study (PheWAS) using UK Biobank data to investigate associations between migraine and 416 phenotypes. Mendelian randomization was employed using the IVW method. For loci associated with multiple diseases, pleiotropy was tested using MR-Egger. Single-cell RNA sequencing data was analyzed to profile the expression of 73 migraine susceptibility genes across brain cell types. qPCR was used to validate the expression of selected genes in microglia. PheWAS identified 15 disorders significantly associated with migraine, with one association detecting potential pleiotropy. Single-cell analysis revealed elevated expression of seven susceptibility genes (including ZEB2, RUNX1, SLC24A3, ANKDD1B, etc.) in brain glial cells. And qPCR confirmed the upregulation of these genes in LPS-treated microglia. This multimodal analysis provides novel insights into the link between migraine and other diseases. The single-cell profiling suggests the involvement of specific brain cells and molecular pathways. Validation of gene expression in microglia supports their potential role in migraine pathology. Overall, this study uncovers pleiotropic relationships and the biological underpinnings of migraine susceptibility.

Also flagged:visionphotonwatermembraneaxonsnanostructures
Journal Article 2024-02-07 No Snippets Muinde J, Zhang TH, Liang ZL, Liu SP, Kioko E, Huang ZZ, Ge SQ.
Show Full Abstract

The functional anatomy of the split compound eyes of whirligig beetles <i>Dineutus mellyi</i> (Coleoptera: Gyrinidae) was examined by advanced microscopy and microcomputed tomography. We report the first 3D visualization and analysis of the split compound eyes. On average, the dorsal and ventral eyes contain 1913 ± 44.5 facets and 3099 ± 86.2 facets, respectively. The larger area of ventral eyes ensures a higher field of vision underwater. The ommatidium of the split compound eyes is made up of laminated cornea lenses that offer protection against mechanical injuries, bullet-shaped crystalline cones that guide light to the photoreceptive regions, and screening pigments that ensure directional light passage. The photoreceptive elements, made up of eight retinular cells, exhibit a tri-tiered rhabdom structure, including the upper distal rhabdom, a clear zone that ensures maximum light passage, and an enlarged lower distal rhabdom that ensures optimal photon capture.

Also flagged:disulfideconopeptidespeptidescysteineamino acidsmembrane receptors
Journal Article 2024-02-07 No Snippets Ratibou Z, Inguimbert N, Dutertre S.
Show Full Abstract

Cone snails are carnivorous marine animals that prey on fish (piscivorous), worms (vermivorous), or other mollusks (molluscivorous). They produce a complex venom mostly made of disulfide-rich conotoxins and conopeptides in a compartmentalized venom gland. The pharmacology of cone snail venom has been increasingly investigated over more than half a century. The rising interest in cone snails was initiated by the surprising high human lethality rate caused by the defensive stings of some species. Although a vast amount of information has been uncovered on their venom composition, pharmacological targets, and mode of action of conotoxins, the venom-ecology relationships are still poorly understood for many lineages. This is especially important given the relatively recent discovery that some species can use different venoms to achieve rapid prey capture and efficient deterrence of aggressors. Indeed, via an unknown mechanism, only a selected subset of conotoxins is injected depending on the intended purpose. Some of these remarkable venom variations have been characterized, often using a combination of mass spectrometry and transcriptomic methods. In this review, we present the current knowledge on such specific predatory and defensive venoms gathered from sixteen different cone snail species that belong to eight subgenera: <i>Pionoconus</i>, <i>Chelyconus</i>, <i>Gastridium</i>, <i>Cylinder</i>, <i>Conus</i>, <i>Stephanoconus</i>, <i>Rhizoconus</i>, and <i>Vituliconus</i>. Further studies are needed to help close the gap in our understanding of the evolved ecological roles of many cone snail venom peptides.

HFE
Also flagged:Alpha-FetoproteinHepatocellular carcinomaliver tumortumorLiver CancerAFP
Journal Article 2024-02-07 ✓ 2 Snippets Gil-Rojas S, Suárez M, Martínez-Blanco P, Torres AM, Martínez-García N, Blasco P, Torralba M, Mateo J.
In-Text Gene Mentions

…HCV, HBV, MASLD,hemochromatosis, autoimmune hepatitis, primar…

…these tumors includehemochromatosis, Wilson’s disease, primary…

Show Full Abstract

Hepatocellular carcinoma (HCC) is the most common primary liver tumor and is associated with high mortality rates. Approximately 80% of cases occur in cirrhotic livers, posing a significant challenge for appropriate therapeutic management. Adequate screening programs in high-risk groups are essential for early-stage detection. The extent of extrahepatic tumor spread and hepatic functional reserve are recognized as two of the most influential prognostic factors. In this retrospective multicenter study, we utilized machine learning (ML) methods to analyze predictors of mortality at the time of diagnosis in a total of 208 patients. The eXtreme gradient boosting (XGB) method achieved the highest values in identifying key prognostic factors for HCC at diagnosis. The etiology of HCC was found to be the variable most strongly associated with a poorer prognosis. The widely used Barcelona Clinic Liver Cancer (BCLC) classification in our setting demonstrated superiority over the TNM classification. Although alpha-fetoprotein (AFP) remains the most commonly used biological marker, elevated levels did not correlate with reduced survival. Our findings suggest the need to explore new prognostic biomarkers for individualized management of these patients.

DCC
Also flagged:Colorectal Cancermalignant tumor of the gastrointestinal tractcancermalignant tumorsagingrectal cancer
Journal Article 2024-02-07 ✓ 2 Snippets Berbecka M, Berbecki M, Gliwa AM, Szewc M, Sitarz R.
In-Text Gene Mentions

The DCC (Deleted in Colorectal Carcinoma) gene is located on the long arm of chromosome 18 and encodes the transmembrane protein DCC which is called the “conditional tumor suppressor gene”.

When the DCC gene is mutated, netrin-1 (ligand produced in the crypts of the colorectal mucosa) does not bind to the DCC transmembrane protein, resulting in abnormal cell survival (apoptosis disorders).

Show Full Abstract

Colorectal cancer (CRC) is a common malignant tumor of the gastrointestinal tract, which has become a serious threat to human health worldwide. This article exhaustively reviews colorectal cancer's incidence and relevance, carcinogenesis molecular pathways, up-to-date treatment opportunities, prophylaxis, and screening program achievements, with attention paid to its regional variations and changes over time. This paper provides a concise overview of known CRC risk factors, including familial, hereditary, and environmental lifestyle-related risk factors. The authors take a closer look into CRC's molecular genetic pathways and the role of specific enzymes involved in carcinogenesis. Moreover, the role of the general practitioner and multidisciplinary approach in CRC treatment is summarized and highlighted based on recent recommendations and experience. This article gives a clear understanding and review of the gains and challenges of modern medicine towards CRC. The authors believe that understanding the current patterns of CRC and its revolution is imperative to the prospects of reducing its burden through cancer prevention and cancer-adjusted treatment.

Also flagged:Gestational diabetes mellitusmetabolic disordersdiabeteschronic hyperglycemiagestationpathogenesis
Journal Article 2024-02-07 No Snippets Suthon S, Tangjittipokin W.
Show Full Abstract

Gestational diabetes mellitus (GDM) is a significant pregnancy complication linked to perinatal complications and an elevated risk of future metabolic disorders for both mothers and their children. GDM is diagnosed when women without prior diabetes develop chronic hyperglycemia due to β-cell dysfunction during gestation. Global research focuses on the association between GDM and single nucleotide polymorphisms (SNPs) and aims to enhance our understanding of GDM's pathogenesis, predict its risk, and guide patient management. This review offers a summary of various SNPs linked to a heightened risk of GDM and explores their biological mechanisms within the tissues implicated in the development of the condition.

Also flagged:IronoxygenFerroptosisdeathliver diseasemetabolism
Journal Article 2024-02-07 No Snippets Gensluckner S, Wernly B, Datz C, Aigner E.
Show Full Abstract

Excess free iron is a substrate for the formation of reactive oxygen species (ROS), thereby augmenting oxidative stress. Oxidative stress is a well-established cause of organ damage in the liver, the main site of iron storage. Ferroptosis, an iron-dependent mechanism of regulated cell death, has recently been gaining attention in the development of organ damage and the progression of liver disease. We therefore summarize the main mechanisms of iron metabolism, its close connection to oxidative stress and ferroptosis, and its particular relevance to disease mechanisms in metabolic-dysfunction-associated fatty liver disease and potential targets for therapy from a clinical perspective.

Also flagged:Perihilar cholangiocarcinomapCCACEANLRtumourMMP9
Journal Article 2024-02-07 No Snippets Pawaskar R, Huang KZ, Pham H, Nagrial A, Wong M, O'Neill S, Pleass H, Yuen L, Lam VWT, Richardson A, Pang T, Nahm CB.
Show Full Abstract

Perihilar cholangiocarcinoma (pCCA) is an uncommon malignancy with generally poor prognosis. Surgery is the primary curative treatment; however, the perioperative mortality and morbidity rates are high, with a low 5-year survival rate. Use of preoperative prognostic biomarkers to predict survival outcomes after surgery for pCCA are not well-established currently. This systematic review aimed to identify and summarise preoperative biomarkers associated with survival in pCCA, thereby potentially improving treatment decision-making. The Embase, Medline, and Cochrane databases were searched, and a systematic review was performed using the PRISMA guidelines. English-language studies examining the association between serum and/or tissue-derived biomarkers in pCCA and overall and/or disease-free survival were included. Our systematic review identified 64 biomarkers across 48 relevant studies. Raised serum CA19-9, bilirubin, CEA, neutrophil-to-lymphocyte ratio (NLR), platelet-to-lymphocyte ratio (PLR) and tumour MMP9, and low serum albumin were most associated with poorer survival; however, the cutoff values used widely varied. Several promising molecular markers with prognostic significance were also identified, including tumour HMGA2, MUC5AC/6, IDH1, PIWIL2, and DNA index. In conclusion, several biomarkers have been identified in serum and tumour specimens that prognosticate overall and disease-free survival after pCCA resection. These, however, require external validation in large cohort studies and/or in preoperatively obtained specimens, especially tissue biopsy, to recommend their use.

Also flagged:Estrogen Receptor AlphaBRCA1Breast Cancersteroidestrogen receptorBazedoxifene
Journal Article 2024-02-07 No Snippets Szmyd M, Zanib A, Behlow V, Hallman E, Pfiffner S, Yaldo R, Prudhomme N, Farrar K, Dinda S.
Show Full Abstract

Selective estrogen receptor modulators (SERMs) are steroid analogs with dual functionality, acting as partial estrogen receptor agonists to preserve postmenopausal bone density and as estrogen receptor antagonists in breast tissue. Bazedoxifene acetate (BZA) is an FDA-approved, third-generation SERM used in the treatment of osteoporosis in women. It demonstrates potential as a therapeutic option for breast cancer patients undergoing endocrine therapy. Our study aimed to assess BZA's effects on Estrogen Receptor Alpha (ERα) and tumor suppressor gene BRCA1 in T-47D and MCF-7 breast cancer cells, using Western blots, cellular viability, apoptosis assays, and RT-qPCR. Cells were cultured in 5% charcoal-stripped fetal bovine serum for six days to deplete endogenous steroids. Following a 24 h exposure to 2 µM BZA (optimal concentration determined from 1 nM-2 µM studies), Western blot analyses revealed reduced ERα and BRCA1 protein levels in both cell lines. ERα decreased by 48-63% and BRCA1 by 61-64%, indicating sensitivity to antiestrogens. Cytolocalization of ERα and BRCA1 remained unchanged after BZA and 17-β-estradiol (E<sub>2</sub>) treatment. ESR1 mRNA expression correlated with Western blot findings. Image cytometric analysis using the stain, propidium iodide, detected decreased cellular proliferation in T-47D and MCF-7 cells following a 6-day treatment ranging from 1 nM to 2 µM BZA. BZA treatment alone led to a tenfold reduction in cellular proliferation compared to estrogen-treated cells, suggesting antiproliferative effects. Understanding BZA's modulation of BRCA1 and ERα, along with their mechanistic interactions, is vital for comprehending its impact on breast cancer tumor suppressors and hormone receptors.

Also flagged:SynthesiscellulosepolysaccharideHydroxyapatitemetaloxide
Journal Article 2024-02-07 No Snippets Sknepnek A, Filipović S, Pavlović VB, Mirković N, Miletić D, Gržetić J, Mirković M.
Show Full Abstract

Bacterial cellulose (BC) is a highly pure polysaccharide biopolymer that can be produced by various bacterial genera. Even though BC lacks functional properties, its porosity, three-dimensional network, and high specific surface area make it a suitable carrier for functional composite materials. In the present study, BC-producing bacteria were isolated from kombucha beverage and identified using a molecular method. Two sets of the BC hydrogels were produced in static conditions after four and seven days. Afterwards, two different synthesis pathways were applied for BC functionalization. The first method implied the incorporation of previously synthesized HAp/TiO<sub>2</sub> nanocomposite using an immersion technique, while the second method included the functionalization of BC during the synthesis of HAp/TiO<sub>2</sub> nanocomposite in the reaction mixture. The primary goal was to find the best method to obtain the functionalized material. Physicochemical and microstructural properties were analyzed by SEM, EDS, FTIR, and XRD methods. Further properties were examined by tensile test and thermogravimetric analysis, and antimicrobial activity was assessed by a total plate count assay. The results showed that HAp/TiO<sub>2</sub> was successfully incorporated into the produced BC hydrogels using both methods. The applied methods of incorporation influenced the differences in morphology, phase distribution, mechanical and thermal properties, and antimicrobial activity against <i>Staphylococcus aureus</i> (ATCC 25923), <i>Escherichia coli</i> (ATCC 25922), <i>Proteus mirabilis</i> (ATCC 12453), and <i>Candida albicans</i> (ATCC 10231). Composite material can be recommended for further development and application in environments that are suitable for diseases spreading.

TNFSF4
Also flagged:pyroptosisprogrammed cell deathGastric cancerCD274CD163FoxP3
Journal Article 2024-02-07 ✓ 1 Snippet Li J, Yu T, Sun J, Ma M, Zheng Z, Kang W, Ye X.
In-Text Gene Mentions

…, TNFSF18 andTNFSF4were significantly upregulated…

Show Full Abstract

Cell pyroptosis, a Gasdermin-dependent programmed cell death characterized by inflammasome, plays a complex and dynamic role in Gastric cancer (GC), a serious threat to human health. Therefore, the value of pyroptosis-related genes (PRGs) as prognostic biomarkers and therapeutic indicators for patients needs to be exploited in GC. This study integrates single-cell RNA sequencing (scRNA-seq) dataset GSE183904 with GC transcriptome data from the TCGA database, focusing on the expression and distribution of PRGs in GC at the single-cell level. The prognostic signature of PRGs was established by using Cox and LASSO analyses. The differences in long-term prognosis, immune infiltration, mutation profile, CD274 and response to chemotherapeutic drugs between the two groups were analyzed and evaluated. A tissue array was used to verify the expression of six PRGs, CD274, CD163 and FoxP3. C12orf75, VCAN, RGS2, MKNK2, SOCS3 and TNFAIP2 were successfully screened out to establish a signature to potently predict the survival time of GC patients. A webserver (https://pumc.shinyapps.io/GastricCancer/) for prognostic prediction in GC patients was developed based on this signature. High-risk score patients typically had worse prognoses, resistance to classical chemotherapy, and a more immunosuppressive tumor microenvironment. VCAN, TNFAIP2 and SOCS3 were greatly elevated in the GC while RGS2 and MKNK2 were decreased in the tumor samples. Further, VCAN was positively related to the infiltrations of Tregs and M2 TAMs in GC TME and the CD274 in tumor cells. In summary, a potent pyroptosis-related signature was established to accurately forecast the survival time and treatment responsiveness of GC patients.

Also flagged:MethylenedioxyphenylAmideMyeloperoxidaseMPODPP-4α-glucosidase
Journal Article 2024-02-07 No Snippets Rajan R, Karthikeyan S, Desikan R.
Show Full Abstract

Novel methylenedioxyphenyl-based amides, especially <i>N</i>-(4-methoxybenzyl)-6-nitrobenzo-[1,3]-dioxole-5-carboxamide (MDC) and <i>N</i>-(3-acetylphenyl)-6-nitrobenzo-[1,3]-dioxole-5-carboxamide (ADC), potential cardiovascular preventive agents, are successfully synthesized, and their chemical structures are verified by <sup>1</sup>H and <sup>13</sup>C NMR, Fourier transform infrared (FT-IR), high-resolution mass spectrometry (HRMS), and single-crystal X-ray diffraction (SC-XRD) analyses. Data obtained from SC-XRD reveal that MDC and ADC are both monoclinic molecules with <i>Z</i> = 2 and 4, respectively. From density functional theory (DFT) calculations, 3.54 and 3.96 eV are the energy gaps of the optimized MDC and ADC structures, respectively. MDC and ADC exhibit an electrophilicity index value of more than 1.5 eV, suggesting that they can act as an electrophile, facilitating bond formation with biomolecules. Hirshfeld surface analysis demonstrates that more than 25% of atomic interactions in both MDC and ADC are from H···H interactions. Based on pharmacokinetic predictions, MDC and ADC exhibit drug-like properties, and molecular docking simulations revealed favorable interactions with active site pockets. Both MDC and ADC achieved higher docking scores of -7.74 and -7.79 kcal/mol, respectively, with myeloperoxidase (MPO) protein. From docking results, MPO was found to be most favorable followed by dipeptidyl peptidase-4 (DPP-4) and α-glucosidase (α-GD). Antioxidant, anti-inflammatory, and <i>in vitro</i> enzymatic studies of MDC and ADC indicate that MDC is more selective toward MPO and more potent than ADC. The application of MDC to inhibit myeloperoxidase could be ascertained to reduce the cardiovascular risk factor. This can be supported from the results of computational docking (based on hydrogen bonding and docking score), <i>in vitro</i> antioxidant and anti-inflammatory properties, and MPO enzymatic inhibition (based on the percentage of inhibition and IC<sub>50</sub> values).

HFE
Also flagged:DulaglutideEmpagliflozinLiver Steatosisdiabetes mellitusglucagon-like peptide 1 receptorsodium-glucose co-transporter 2
Journal Article 2024-02-07 ✓ 1 Snippet Koullias E, Papavdi M, Athanasopoulos S, Mitrakou A, Deutsch M, Zoumpoulis P, Manesis E, Thanopoulou A, Koskinas J.
In-Text Gene Mentions

…abuse, autoimmune hepatitis,hemochromatosis, heart failure, etc.),…

Show Full Abstract

Background Patients with liver steatosis and diabetes mellitus can benefit from medications like glucagon-like peptide 1 receptor agonists or sodium-glucose co-transporter 2 inhibitors, as far as both hyperglycemia and fatty liver are concerned. Studies comparing members of both these families have not yet been published. We aimed to compare the effects of Empagliflozin and Dulaglutide, focusing primarily on liver steatosis. Methodology This prospective, observational, controlled study enrolled 78 patients from two centers in Athens, Greece. Adults with type 2 diabetes mellitus (DM2) and nonalcoholic fatty liver disease were assigned to one of three groups and received either Empagliflozin or Dulaglutide or any other medical treatment deemed appropriate by their physician. The primary endpoint was the reduction in liver fat fraction, assessed using magnetic resonance imaging-proton density fat fraction. Additionally, we evaluated the proportion of patients achieving a relative reduction above 30% of their initial liver fat concentration. Results The Empagliflozin group exhibited a reduction in liver fat fraction. Furthermore, the percentage of patients with a relative reduction of liver steatosis, >30%, was significantly larger in this group, compared to the Dulaglutide and Control groups. Significant body weight reduction was observed in all three groups, but no improvement in fibrosis assessing scores was noted. Conclusions Empagliflozin is effective in improving liver steatosis, while Dulaglutide does not exhibit a similar effect. Larger studies, comparing these or related agents, are necessary, to further assess benefits in patients with DM2 and nonalcoholic fatty liver.

HTT
Also flagged:ALSC9orf72dipeptideautophagypathogenesisamyotrophic lateral sclerosis
Journal Article 2024-02-07 ✓ 5 Snippets Xu S, Ma Q, Shen J, Li N, Sun S, Wang N, Chen Y, Dong C, Tam KY, Prehn JHM, Wang H, Ying Z.
In-Text Gene Mentions

…-TFEB, GFP-BCL2, GFP-LC3, GFP-Htt-60Q, GFP-Htt-150Q, GFP-BCL2, …

…L2, GFP-LC3, GFP-Htt-60Q, GFP-Htt-150Q, GFP-BCL2, FLAG, FLAG-BE…

…containing 60 poly-Q (Htt-60Q) and 150 poly-Q…

…and 150 poly-Q (Htt-150Q), which reflects the…

…autophagic clearance ofHtt-60Q and Htt-150Q aggregates…

Show Full Abstract

Growing evidences indicate that dysfunction of autophagy contributes to the disease pathogenesis of amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD), two neurodegenerative disorders. The GGGGCC·GGCCCC repeat RNA expansion in chromosome 9 open reading frame 72 (<i>C9orf72</i>) is the most genetic cause of both ALS and FTD. According to the previous studies, GGGGCC·GGCCCC repeat undergoes the unconventional repeat-associated non-ATG translation, which produces dipeptide repeat (DPR) proteins. Although there is a growing understanding that <i>C9orf72</i> DPRs have a strong ability to harm neurons and induce <i>C9orf72</i>-linked ALS/FTD, whether these DPRs can affect autophagy remains unclear. In the present study, we find that poly-GR and poly-PR, two arginine-containing DPRs which display the most cytotoxic properties according to the previous studies, strongly inhibit starvation-induced autophagy. Moreover, our data indicate that arginine-rich DPRs enhance the interaction between BCL2 and BECN1/Beclin 1 by inhibiting BCL2 phosphorylation, therefore they can impair autophagic clearance of neurodegenerative disease-associated protein aggregates under starvation condition in cells. Importantly, our study not only highlights the role of <i>C9orf72</i> DPR in autophagy dysfunction, but also provides novel insight that pharmacological intervention of autophagy using SW063058, a small molecule compound that can disrupt the interaction between BECN1 and BCL2, may reduce <i>C9orf72</i> DPR-induced neurotoxicity.

Also flagged:organizationbreast cancerestradiolpropylestrogenlumen
Journal Article 2024-02-06 No Snippets Li H, Seada H, Madnick S, Zhao H, Chen Z, Li F, Zhu F, Hall S, Boekelheide K.
Show Full Abstract

Endocrine-disrupting chemicals (EDCs) pose a significant threat to human well-being and the ecosystem. However, in managing the many thousands of uncharacterized chemical entities, the high-throughput screening of EDCs using relevant biological endpoints remains challenging. Three-dimensional (3D) culture technology enables the development of more physiologically relevant systems in more realistic biochemical microenvironments. The high-content and quantitative imaging techniques enable quantifying endpoints associated with cell morphology, cell-cell interaction, and microtissue organization. In the present study, 3D microtissues formed by MCF-7 breast cancer cells were exposed to the model EDCs estradiol (E2) and propyl pyrazole triol (PPT). A 3D imaging and image analysis pipeline was established to extract quantitative image features from estrogen-exposed microtissues. Moreover, a machine-learning classification model was built using estrogenic-associated differential imaging features. Based on 140 common differential image features found between the E2 and PPT group, the classification model predicted E2 and PPT exposure with AUC-ROC at 0.9528 and 0.9513, respectively. Deep learning-assisted analysis software was developed to characterize microtissue gland lumen formation. The fully automated tool can accurately characterize the number of identified lumens and the total luminal volume of each microtissue. Overall, the current study established an integrated approach by combining non-supervised image feature profiling and supervised luminal volume characterization, which reflected the complexity of functional ER signaling and highlighted a promising conceptual framework for estrogenic EDC risk assessment.

Also flagged:tenofovir disoproxil fumaratetenofovir alafenamideentecavirchronic hepatitis Bcirrhosishepatocellular carcinoma
Journal Article 2024-02-06 No Snippets Sinakos E, Kachru N, Tsoulas C, Jeyakumar S, Smith NJ, Yehoshua A, Cholongitas E.
Show Full Abstract

<b>Aim:</b> This study assessed the clinical impact and cost-effectiveness of switching from tenofovir disoproxil fumarate (TDF) to either tenofovir alafenamide (TAF) or entecavir (ETV) in a Greek chronic hepatitis B (CHB) population. <b>Patients & methods:</b> A Markov model from the perspective of a third-party payer in Greece quantified the health and economic benefits of switching from TDF to either TAF or ETV over a lifetime horizon. <b>Results:</b> Over a lifetime, patients who switch from TDF to TAF versus patients who switch from TDF to ETV had an overall lower incidence of compensated cirrhosis (0.4% lower), decompensated cirrhosis (0.04% lower) and hepatocellular carcinoma (0.25% lower). Chronic kidney disease and end-stage renal disease were also lower in patients who switch to TAF; major osteoporotic fractures were similar for both groups. While total costs were higher for switching from TDF to TAF versus TDF to ETV due to the higher cost of TAF, switching from TDF to TAF versus ETV was cost effective with an incremental cost-effectiveness ratio of €17,113 per quality-adjusted life year. <b>Conclusion:</b> Switching from TDF to TAF in patients living with CHB is a cost effective strategy to reduce adverse liver disease outcomes, while improving bone- and renal-related safety outcomes.

Also flagged:carbonperfluorooctanoic acidperfluorooctanesulfonic acidperfluorobutanoic acidperfluorobutanesulfonic acidperfluorohexanoic acid
Journal Article 2024-02-06 No Snippets Shirke AV, Radke EG, Lin C, Blain R, Vetter N, Lemeris C, Hartman P, Hubbard H, Angrish M, Arzuaga X, Congleton J, Davis A, Dishaw LV, Jones R, Judson R, Kaiser JP, Kraft A, Lizarraga L, Noyes PD, Patlewicz G, Taylor M, Williams AJ, Thayer KA, Carlson LM.
Show Full Abstract

<h4>Background</h4>Per- and polyfluoroalkyl substances (PFAS) encompass a class of chemically and structurally diverse compounds that are extensively used in industry and detected in the environment. The US Environmental Protection Agency (US EPA) 2021 PFAS Strategic Roadmap describes national research plans to address the challenge of PFAS.<h4>Objectives</h4>Systematic Evidence Map (SEM) methods were used to survey and summarize available epidemiological and mammalian bioassay evidence that could inform human health hazard identification for a set of 345 PFAS that were identified by the US EPA's Center for Computational Toxicology and Exposure (CCTE) for <i>in vitro</i> toxicity and toxicokinetic assay testing and through interagency discussions on PFAS of interest. This work builds from the 2022 evidence map that collated evidence on a separate set of ∼150 PFAS. Like our previous work, this SEM does not include PFAS that are the subject of ongoing or completed assessments at the US EPA.<h4>Methods</h4>SEM methods were used to search, screen, and inventory mammalian bioassay and epidemiological literature from peer-reviewed and gray literature sources using manual review and machine-learning software. For each included study, study design details and health end points examined were summarized in interactive web-based literature inventories. Some included studies also underwent study evaluation and detailed extraction of health end point data. All underlying data is publicly available online as interactive visuals with downloadable metadata.<h4>Results</h4>More than 13,000 studies were identified from scientific databases. Screening processes identified 121 mammalian bioassay and 111 epidemiological studies that met screening criteria. Epidemiological evidence (available for 12 PFAS) mostly assessed the reproductive, endocrine, developmental, metabolic, cardiovascular, and immune systems. Mammalian bioassay evidence (available for 30 PFAS) commonly assessed effects in the reproductive, whole-body, nervous, and hepatic systems. Overall, 41 PFAS had evidence across mammalian bioassay and epidemiology data streams (roughly 11% of searched chemicals).<h4>Discussion</h4>No epidemiological and/or mammalian bioassay evidence were identified for most of the PFAS included in our search. Results from this SEM, our 2022 SEM on ∼150 PFAS, and other PFAS assessment products from the US EPA are compiled into a comprehensive PFAS dashboard that provides researchers and regulators an overview of the current PFAS human health landscape including data gaps and can serve as a scoping tool to facilitate prioritization of PFAS-related research and/or risk assessment activities. https://doi.org/10.1289/EHP13423.

Also flagged:PSMA7chromosometumorscancersgene expressioncancer
Journal Article 2024-02-06 No Snippets Sheng G, Li F, Jin W, Wang K.
Show Full Abstract

The chromosome 20 long arm (20q) is one of the genomic hotspots where copy number alterations frequently occur in multiple types of tumors. However, it remains elusive which genes are implicated in 20q-related tumorigenesis. Here, by querying TCGA and GEO databases, we observed frequent copy number amplification at 20q and the chromosome subband 20q13.33 was amplificated in multiple cancers. Among those genes at 20q13.33, PSMA7 was found with the strongest correlation with cancers. Further analysis revealed that PSMA7 amplification was the most frequent genetic alteration event conferring adverse prognosis in various cancers. Consistent with the strong positive correlation between PSMA7 amplification and gene expression, elevated PSMA7 expression was observed in 20 of 33 types of cancers with a close link to adverse outcomes in certain tumors. In addition, PSMA7 was essential for the growth of almost 1095 cancer lines. Mechanistically, aberrant PSMA7 most probably influenced the proteasome and protease-related pathways to promote tumorigenesis and might be antagonized by several compounds, e.g., Docetaxel in relevant cancers. The current in-depth pan-cancer analysis refines our understanding of the crucial oncogenic role of copy number amplifications at PSMA7 loci at the novel chromosome amplicon 20q13.33 across different tumors.

POU3F2SOX6
Also flagged:Gliomastumororganizationgliomagestationneurogenesis
Journal Article 2024-02-06 ✓ 2 Snippets Sojka C, Sloan SA.
In-Text Gene Mentions

…TFs, including Sox5,Sox6, Hes5, Id2, and…

…such as ASCL1,POU3F2, SOX2, SALL2, and…

Show Full Abstract

The hijacking of early developmental programs is a canonical feature of gliomas where neoplastic cells resemble neurodevelopmental lineages and possess mechanisms of stem cell resilience. Given these parallels, uncovering how and when in developmental time gliomagenesis intersects with normal trajectories can greatly inform our understanding of tumor biology. Here, we review how elapsing time impacts the developmental principles of astrocyte (AS) and oligodendrocyte (OL) lineages, and how these same temporal programs are replicated, distorted, or circumvented in pathological settings such as gliomas. Additionally, we discuss how normal gliogenic processes can inform our understanding of the temporal progression of gliomagenesis, including when in developmental time gliomas originate, thrive, and can be pushed towards upon therapeutic coercion.

SERPINC1
Also flagged:intestinal diseasesagingcolorectal cancertryptophanmetabolismkynurenine
Journal Article 2024-02-06 ✓ 1 Snippet Wang X, Luo Y, He S, Lu Y, Gong Y, Gao L, Mao S, Liu X, Jiang N, Pu Q, Du D, Shu Y, Hai S, Li S, Chen HN, Zhao Y, Xie D, Qi S, Lei P, Hu H, Xu H, Zhou ZG, Dong B, Zhang H, Zhang Y, Dai L.
In-Text Gene Mentions

Remarkably, nine genes—namely, SH3BGR, LIPE, HPX, DBNL, CCT8, SERPINC1, NFU1, L1CAM and STX1A—were found to affect both intestinal atrophy and barrier integrity.

Show Full Abstract

The incidence of intestinal diseases increases with age, yet the mechanisms governing gut aging and its link to diseases, such as colorectal cancer (CRC), remain elusive. In this study, while considering age, sex and proximal-distal variations, we used a multi-omics approach in non-human primates (Macaca fascicularis) to shed light on the heterogeneity of intestinal aging and identify potential regulators of gut aging. We explored the roles of several regulators, including those from tryptophan metabolism, in intestinal function and lifespan in Caenorhabditis elegans. Suggesting conservation of region specificity, tryptophan metabolism via the kynurenine and serotonin (5-HT) pathways varied between the proximal and distal colon, and, using a mouse colitis model, we observed that distal colitis was more sensitive to 5-HT treatment. Additionally, using proteomics analysis of human CRC samples, we identified links between gut aging and CRC, with high HPX levels predicting poor prognosis in older patients with CRC. Together, this work provides potential targets for preventing gut aging and associated diseases.

HFE
Also flagged:Neurodevelopmental disordersIntellectual disabilityfragile Xbrain developmentautismautism spectrum disorders
Journal Article 2024-02-06 ✓ 1 Snippet Wayhelova M, Vallova V, Broz P, Mikulasova A, Smetana J, Dynkova Filkova H, Machackova D, Handzusova K, Gaillyova R, Kuglik P.
In-Text Gene Mentions

…BRCA2 (rs80359351) ,HFE(rs1800562) , TGFBR1…

Show Full Abstract

<h4>Background</h4>Neurodevelopmental disorders (NDDs) and/or associated multiple congenital abnormalities (MCAs) represent a genetically heterogeneous group of conditions with an adverse prognosis for the quality of intellectual and social abilities and common daily functioning. The rapid development of exome sequencing (ES) techniques, together with trio-based analysis, nowadays leads to up to 50% diagnostic yield. Therefore, it is considered as the state-of-the-art approach in these diagnoses.<h4>Results</h4>In our study, we present the results of ES in a cohort of 85 families with 90 children with severe NDDs and MCAs. The interconnection of the in-house bioinformatic pipeline and a unique algorithm for variant prioritization resulted in a diagnostic yield of up to 48.9% (44/90), including rare and novel causative variants (41/90) and intragenic copy-number variations (CNVs) (3/90). Of the total number of 47 causative variants, 53.2% (25/47) were novel, highlighting the clinical benefit of ES for unexplained NDDs. Moreover, trio-based ES was verified as a reliable tool for the detection of rare CNVs, ranging from intragenic exon deletions (GRIN2A, ZC4H2 genes) to a 6-Mb duplication. The functional analysis using PANTHER Gene Ontology confirmed the involvement of genes with causative variants in a wide spectrum of developmental processes and molecular pathways, which form essential structural and functional components of the central nervous system.<h4>Conclusion</h4>Taken together, we present one of the first ES studies of this scale from the central European region. Based on the high diagnostic yield for paediatric NDDs in this study, 48.9%, we confirm trio-based ES as an effective and reliable first-tier diagnostic test in the genetic evaluation of children with NDDs.

DARS2
Also flagged:lung adenocarcinomamitochondrial aspartyl-tRNA synthetase 2cancersGene ExpressionLUADPI3K
Journal Article 2024-02-06 ✓ 5 Snippets Xu Y, Chen X.
In-Text Gene Mentions

To validate the role of DARS2 in LUAD progression, a subcutaneous xenograft mouse model was established and explored the findings in vivo.

Similarly, the Western blot analysis also validated the amplification of DARS2 protein expression in the LUAD tissues (Fig. 1i).

DARS2 overexpression relates to the dismal clinical outcome of LUAD patients

GEPIA database was used to analyze the expression and the prognostic relevance of DARS2 in LUAD tissues.

Although there was no association with age, tumor size, and sex, the clinicopathological analysis by chi-square test indicated that DARS2 expression was associated with the Tumor-Node-Metastasis (TNM) stage and high lymph node metastasis (p values of 0.0082 and 0.0147, respectively, Table 1).

Show Full Abstract

<h4>Background</h4>The aberrant intracellular expression of a mitochondrial aspartyl-tRNA synthetase 2 (DARS2) has been reported in human cancers. Nevertheless, its critical role and detailed mechanism in lung adenocarcinoma (LUAD) remain unexplored.<h4>Methods</h4>Initially, The Cancer Genome Atlas (TCGA)-based Gene Expression Profiling Interactive Analysis (GEPIA) database (http://gepia.cancer-pku.cn/) was used to analyze the prognostic relevance of DARS2 expression in LUAD. Further, cell counting kit (CCK)-8, immunostaining, and transwell invasion assays in LUAD cell lines <i>in vitro</i>, as well as DARS2 silence on LUAD by tumorigenicity experiments <i>in vivo</i> in nude mice, were performed. Besides, we analyzed the expression levels of p-PI3K (phosphorylated-Phosphotylinosital3 kinase), PI3K, AKT (Protein Kinase B), p-AKT (phosphorylated-Protein Kinase B), PCNA (proliferating cell nuclear antigen), cleaved-caspase 3, E-cadherin, and N-cadherin proteins using the Western blot analysis.<h4>Results</h4>LUAD tissues showed higher DARS2 expression compared to normal tissues. Upregulation of DARS2 could be related to Tumor-Node-Metastasis (TNM) stage, high lymph node metastasis, and inferior prognosis. DARS2 silence decreased the proliferation, migration, and invasion abilities of LUAD cells. In addition, the DARS2 downregulation decreased the PCNA and N-cadherin expression and increased cleaved-caspase 3 and E-cadherin expressions in LUAD cells, coupled with the inactivation of the PI3K/AKT signaling pathway. Moreover, DARS2 silence impaired the tumorigenicity of LUAD <i>in vivo</i>. Interestingly, let-7b-5p could recognize DARS2 through a complementary sequence. Mechanistically, the increased let-7b-5p expression attenuated the promo-oncogenic action of DARS2 during LUAD progression, which were inversely correlated to each other in the LUAD tissues.<h4>Conclusion</h4>In summary, let-7b-5p downregulated DARS2 expression, regulating the progression of LUAD cells by the PI3K/AKT signaling pathway.

BTN2A2
Also flagged:Glycogenmetabolismtumorhepatocellular carcinomaimmune responsetranscription factors
Journal Article 2024-02-06 ✓ 1 Snippet Zhang Y, Qin N, Wang X, Liang R, Liu Q, Geng R, Jiang T, Liu Y, Li J.
In-Text Gene Mentions

…une checkpoint-related genes (BTN2A2, LGALS9, TIGIT, BTLA,…

Show Full Abstract

Glycogen metabolism plays a key role in the development of hepatocellular carcinoma (HCC), but the function of glycogen metabolism genes in the tumor microenvironment (TME) is still to be elucidated. Single-cell RNA-seq data were obtained from ten HCC tumor samples totaling 64,545 cells, and 65 glycogen metabolism genes were analyzed by a nonnegative matrix factorization (NMF). The prognosis and immune response of new glycogen TME cell clusters were predicted by using HCC and immunotherapy cohorts from public databases. HCC single-cell analysis was divided into fibroblasts, NT T cells, macrophages, endothelial cells, and B cells, which were separately divided into new cell clusters by glycogen metabolism gene annotation. Pseudo-temporal trajectory analysis demonstrated the temporal differentiation trajectory of different glycogen subtype cell clusters. Cellular communication analysis revealed extensive interactions between endothelial cells with glycogen metabolizing TME cell-related subtypes and different glycogen subtype cell clusters. SCENIC analysis of transcription factors upstream of TME cell clusters with different glycogen metabolism. In addition, TME cell clusters of glycogen metabolism were found to be enriched in expression in CAF subtypes, CD8 depleted, M1, and M2 types. Bulk-seq analysis showed the prognostic significance of glycogen metabolism-mediated TME cell clusters in HCC, while a significant immune response was found in the immunotherapy cohort in patients treated with immune checkpoint blockade (ICB), especially for CAFs, T cells, and macrophages. In summary, our study reveals for the first time that glycogen metabolism mediates intercellular communication in the hepatocellular carcinoma microenvironment while elucidating the anti-tumor mechanisms and immune prognostic responses of different subtypes of cell clusters.

Also flagged:osteosarcomaendoplasmic reticulummetastatic osteosarcomagene expressiontumorbone tumor
Journal Article 2024-02-06 No Snippets Wu WQ, Zou CD, Wu D, Fu HX, Wang XD, Yao F.
Show Full Abstract

<h4>Introduction</h4>Osteosarcoma, the prevailing primary bone malignancy among children and adolescents, is frequently associated with treatment failure primarily due to its pronounced metastatic nature.<h4>Methods</h4>This study aimed to establish potential associations between hub genes and subtypes for the treatment of metastatic osteosarcoma. Differentially expressed genes were extracted from patients diagnosed with metastatic osteosarcoma and a control group of non-metastatic patients, using the publicly available gene expression profile (GSE21257). The intersection of these gene sets was determined by focusing on endoplasmic reticulum (ER) stress-related genes sourced from the GeneCards database. We conducted various analytical techniques, including functional and pathway enrichment analysis, WGCNA analysis, protein-protein interaction (PPI) network construction, and assessment of immune cell infiltration, using the intersecting genes. Through this analysis, we identified potential hub genes.<h4>Results</h4>Osteosarcoma subtype models were developed using molecular consensus clustering analysis, followed by an examination of the associations between each subtype and hub genes. A total of 138 potential differentially expressed genes related to endoplasmic reticulum (ER) stress were identified. These genes were further investigated using Gene Ontology (GO), Kyoto Encyclopedia of Genes and Genomes (KEGG), and Gene Set Enrichment Analysis (GSEA) pathways. Additionally, the PPI interaction network revealed 38 interaction relationships among the top ten hub genes. The findings of the analysis revealed a strong correlation between the extent of immune cell infiltration and both osteosarcoma metastasis and the expression of hub genes. Notably, the differential expression of the top ten hub genes was observed in osteosarcoma clusters 1 and 4, signifying their significant association with the disease.<h4>Conclusion</h4>The identification of ten key genes linked to osteosarcoma metastasis and endoplasmic reticulum stress bears potential clinical significance. Additionally, exploring the molecular subtype of osteosarcoma has the capacity to guide clinical treatment decisions, necessitating further investigations and subsequent clinical validations.

Also flagged:Hydroxyapatiteanion channellithium+synthesisLi +
Journal Article 2024-02-06 No Snippets Goldberg MA, Gafurov MR, Makshakova ON, Smirnov SV, Fomin AS, Murzakhanov FF, Komlev VS.
Show Full Abstract

Hydroxyapatite (HA) remains one of the most popular materials for various biomedical applications and its fields of application have been expanding. Lithium (Li<sup>+</sup>) is a promising candidate for modifying the biological behavior of HA. Li<sup>+</sup> is present in trace amounts in the human body as an alkaline and bioelectric material. At the same time, the introduction of Li<sup>+</sup> into the HA structure required charge balance compensation due to the difference in oxidation degree, and the scheme of this compensation is still an open question. In the present work, the results of the theoretical and experimental study of the Li<sup>+</sup>-doped HA synthesis are presented. According to X-ray diffraction data, Fourier transform infrared spectroscopy as well as the combination of electron paramagnetic resonance methods, the introduction of Li<sup>+</sup> in the amount up to 0.05 mol% resulted in the preservation of the HA structure. Density functional theory calculations show that Li<sup>+</sup> preferentially incorporates into the Ca (1) position with a small geometry perturbation. The less probable positioning in the Ca (2) position leads to a drastic perturbation of the anion channel.

Also flagged:Calcium Phosphatecalcium phosphatesextracellularmineralporecell growth
Journal Article 2024-02-06 No Snippets Tolmacheva N, Bhattacharyya A, Noh I.
Show Full Abstract

Three-dimensional bioprinting is a promising technology for bone tissue engineering. However, most hydrogel bioinks lack the mechanical and post-printing fidelity properties suitable for such hard tissue regeneration. To overcome these weak properties, calcium phosphates can be employed in a bioink to compensate for the lack of certain characteristics. Further, the extracellular matrix of natural bone contains this mineral, resulting in its structural robustness. Thus, calcium phosphates are necessary components of bioink for bone tissue engineering. This review paper examines different recently explored calcium phosphates, as a component of potential bioinks, for the biological, mechanical and structural properties required of 3D bioprinted scaffolds, exploring their distinctive properties that render them favorable biomaterials for bone tissue engineering. The discussion encompasses recent applications and adaptations of 3D-printed scaffolds built with calcium phosphates, delving into the scientific reasons behind the prevalence of certain types of calcium phosphates over others. Additionally, this paper elucidates their interactions with polymer hydrogels for 3D bioprinting applications. Overall, the current status of calcium phosphate/hydrogel bioinks for 3D bioprinting in bone tissue engineering has been investigated.

PRDX6
Also flagged:DeathOral CancerOSCChead and neck cancerferroptosispyroptosis
Journal Article 2024-02-06 ✓ 1 Snippet Siquara da Rocha LO, de Morais EF, de Oliveira LQR, Barbosa AV, Lambert DW, Gurgel Rocha CA, Coletta RD.
In-Text Gene Mentions

…and peroxiredoxin 6 (PRDX6).…

Show Full Abstract

Oral squamous cell carcinoma (OSCC) is the most common and lethal type of head and neck cancer in the world. Variable response and acquisition of resistance to traditional therapies show that it is essential to develop novel strategies that can provide better outcomes for the patient. Understanding of cellular and molecular mechanisms of cell death control has increased rapidly in recent years. Activation of cell death pathways, such as the emerging forms of non-apoptotic programmed cell death, including ferroptosis, pyroptosis, necroptosis, NETosis, parthanatos, mitoptosis and paraptosis, may represent clinically relevant novel therapeutic opportunities. This systematic review summarizes the recently described forms of cell death in OSCC, highlighting their potential for informing diagnosis, prognosis and treatment. Original studies that explored any of the selected cell deaths in OSCC were included. Electronic search, study selection, data collection and risk of bias assessment tools were realized. The literature search was carried out in four databases, and the extracted data from 79 articles were categorized and grouped by type of cell death. Ferroptosis, pyroptosis, and necroptosis represented the main forms of cell death in the selected studies, with links to cancer immunity and inflammatory responses, progression and prognosis of OSCC. Harnessing the potential of these pathways may be useful in patient-specific prognosis and individualized therapy. We provide perspectives on how these different cell death types can be integrated to develop decision tools for diagnosis, prognosis, and treatment of OSCC.

Also flagged:ureaureasebindingthioureaHelicobacter pyloriHp
Journal Article 2024-02-06 No Snippets Valenzuela-Hormazabal P, Sepúlveda RV, Alegría-Arcos M, Valdés-Muñoz E, Rojas-Pérez V, González-Bonet I, Suardíaz R, Galarza C, Morales N, Leddermann V, Castro RI, Benso B, Urra G, Hernández-Rodríguez EW, Bustos D.
Show Full Abstract

<i>Helicobacter pylori</i> (<i>Hp</i>) infections pose a global health challenge demanding innovative therapeutic strategies by which to eradicate them. Urease, a key <i>Hp</i> virulence factor hydrolyzes urea, facilitating bacterial survival in the acidic gastric environment. In this study, a multi-methodological approach combining pharmacophore- and structure-based virtual screening, molecular dynamics simulations, and MM-GBSA calculations was employed to identify novel inhibitors for <i>Hp</i> urease (<i>Hp</i>U). A refined dataset of 8,271,505 small molecules from the ZINC15 database underwent pharmacokinetic and physicochemical filtering, resulting in 16% of compounds for pharmacophore-based virtual screening. Molecular docking simulations were performed in successive stages, utilizing HTVS, SP, and XP algorithms. Subsequent energetic re-scoring with MM-GBSA identified promising candidates interacting with distinct urease variants. Lys219, a residue critical for urea catalysis at the urease binding site, can manifest in two forms, neutral (LYN) or carbamylated (KCX). Notably, the evaluated molecules demonstrated different interaction and energetic patterns in both protein variants. Further evaluation through ADMET predictions highlighted compounds with favorable pharmacological profiles, leading to the identification of 15 candidates. Molecular dynamics simulations revealed comparable structural stability to the control DJM, with candidates 5, 8 and 12 (CA5, CA8, and CA12, respectively) exhibiting the lowest binding free energies. These inhibitors suggest a chelating capacity that is crucial for urease inhibition. The analysis underscores the potential of CA5, CA8, and CA12 as novel <i>Hp</i>U inhibitors. Finally, we compare our candidates with the chemical space of urease inhibitors finding physicochemical similarities with potent agents such as thiourea.

Also flagged:Tryptophan SynthasesTryptophan synthasetryptophanbiosynthesisindoleL-tryptophan
Journal Article 2024-02-06 No Snippets Martins NF, Viana MJA, Maigret B.
Show Full Abstract

Tryptophan synthase (TRPS) is a complex enzyme responsible for tryptophan biosynthesis. It occurs in bacteria, plants, and fungi as an αββα heterotetramer. Although encoded by independent genes in bacteria and plants, in fungi, TRPS is generated by a single gene that concurrently expresses the α and β entities, which are linked by an elongated peculiar segment. We conducted 1 µs all-atom molecular dynamics simulations on <i>Hemileia vastatrix</i> TRPS to address two questions: (i) the role of the linker segment and (ii) the comparative mode of action. Since there is not an experimental structure, we started our simulations with homology modeling. Based on the results, it seems that TRPS makes use of an already-existing tunnel that can spontaneously move the indole moiety from the α catalytic pocket to the β one. Such behavior was completely disrupted in the simulation without the linker. In light of these results and the αβ dimer's low stability, the full-working TRPS single genes might be the result of a particular evolution. Considering the significant losses that <i>Hemileia vastatrix</i> causes to coffee plantations, our next course of action will be to use the TRPS to look for substances that can block tryptophan production and therefore control the disease.

Also flagged:PD-L1Cuproptosispyruvate dehydrogenase kinase 1OMPtumorglutathione
Journal Article 2024-02-06 No Snippets Yan C, Liu Y, Zhao G, Yang H, Lv H, Li G, Li Y, Fu Y, Sun F, Feng Y, Li Y, Zhao Z.
Show Full Abstract

Cuproptosis shows enormous application prospects in lung metastasis treatment. However, the glycolysis, Cu<sup>+</sup> efflux mechanisms, and insufficient lung drug accumulation severely restrict cuproptosis efficacy. Herein, an inhalable poly (2-(<i>N</i>-oxide-<i>N</i>,<i>N</i>-diethylamino)ethyl methacrylate) (OPDEA)-coated copper-based metal-organic framework encapsulating pyruvate dehydrogenase kinase 1 siRNA (siPDK) is constructed for mediating cuproptosis and subsequently promoting lung metastasis immunotherapy, namely OMP. After inhalation, OMP shows highly efficient lung accumulation and long-term retention, ascribing to the OPDEA-mediated pulmonary mucosa penetration. Within tumor cells, OMP is degraded to release Cu<sup>2+</sup> under acidic condition, which will be reduced to toxic Cu<sup>+</sup> to induce cuproptosis under glutathione (GSH) regulation. Meanwhile, siPDK released from OMP inhibits intracellular glycolysis and adenosine-5'-triphosphate (ATP) production, then blocking the Cu<sup>+</sup> efflux protein ATP7B, thereby rendering tumor cells more sensitive to OMP-mediated cuproptosis. Moreover, OMP-mediated cuproptosis triggers immunogenic cell death (ICD) to promote dendritic cells (DCs) maturation and CD8<sup>+</sup> T cells infiltration. Notably, OMP-induced cuproptosis up-regulates membrane-associated programmed cell death-ligand 1 (PD-L1) expression and induces soluble PD-L1 secretion, and thus synergizes with anti-PD-L1 antibodies (aPD-L1) to reprogram immunosuppressive tumor microenvironment, finally yielding improved immunotherapy efficacy. Overall, OMP may serve as an efficient inhalable nanoplatform and afford preferable efficacy against lung metastasis through inducing cuproptosis and combining with aPD-L1.

Also flagged:Small cell lung cancernon-small cell lung cancerLung cancercancersmall-cell lung cancerSCLC
Journal Article 2024-02-06 No Snippets Yang Y, Fan S.
Show Full Abstract

Lung cancer is a leading cause of cancer deaths worldwide, consisting of two major histological subtypes: small-cell lung cancer (SCLC) and non-small-cell lung cancer (NSCLC). In some cases, NSCLC patients may undergo a histological transformation to SCLC during clinical treatments, which is associated with resistance to targeted therapy, immunotherapy, or chemotherapy. The review provides a comprehensive analysis of SCLC transformation from NSCLC, including biological mechanism, clinical relevance, and potential treatment options after transformation, which may give a better understanding of SCLC transformation and provide support for further research to define better therapy options.

HTT
Also flagged:serotoninlyxosedegradationpeptidoglycanmembranemethylerythritol
Journal Article 2024-02-06 ✓ 1 Snippet Borgiani G, Possidente C, Fabbri C, Oliva V, Bloemendaal M, Arias Vasquez A, Dinan TG, Vieta E, Menchetti M, De Ronchi D, Serretti A, Fanelli G.
In-Text Gene Mentions

…transporter (SERT or5-HTT) – and Clostridiaceae…

Show Full Abstract

This review synthesizes the evidence on associations between antidepressant use and gut microbiota composition and function, exploring the microbiota's possible role in modulating antidepressant treatment outcomes. Antidepressants exert an influence on measures of gut microbial diversity. The most consistently reported differences were in β-diversity between those exposed to antidepressants and those not exposed, with longitudinal studies supporting a potential causal association. Compositional alterations in antidepressant users include an increase in the Bacteroidetes phylum, Christensenellaceae family, and Bacteroides and Clostridium genera, while a decrease was found in the Firmicutes phylum, Ruminococcaceae family, and Ruminococcus genus. In addition, antidepressants attenuate gut microbial differences between depressed and healthy individuals, modulate microbial serotonin transport, and influence microbiota's metabolic functions. These include lyxose degradation, peptidoglycan maturation, membrane transport, and methylerythritol phosphate pathways, alongside gamma-aminobutyric acid metabolism. Importantly, baseline increased α-diversity and abundance of the Roseburia and Faecalibacterium genera, in the Firmicutes phylum, are associated with antidepressant response, emerging as promising biomarkers. This review highlights the potential for gut microbiota as a predictor of treatment response and emphasizes the need for further research to elucidate the mechanisms underlying antidepressant-microbiota interactions. More homogeneous studies and standardized techniques are required to confirm these initial findings.

HFE
Also flagged:hepatocellular carcinomacancersliver diseasehepatocarcinomatumorcancer
Journal Article 2024-02-06 ✓ 1 Snippet Espinoza Loyola PS, Muratalla Bautista DL, Hernández Bautista KA, White EG, González Moreno JA, Torres Del Real DA, Páez Zayas VM, Escorza-Molina C, Rodríguez FM, Gómez OV, Fernández López LJ, Mogrovejo Vázquez PS, Sánchez-Cedillo IA, Visag Castillo VJ.
In-Text Gene Mentions

…for HCC include:hemochromatosis, biliary disease such…

Show Full Abstract

Hepatocellular carcinoma (HCC) is one of the most common cancers in the world and is one of the leading indications for liver transplantation, liver transplantation is the gold standard treatment for end stage liver disease. Diagnosis is based up on radiological characteristics and rarely biopsy results. However treatment must be individualized to each patient to improve recurrences and outcomes. In this article, we focus on the different selection criteria for liver transplantation. This study aimed to investigate the distribution laws and research frontiers of international literature, so as to present holistic bibliometric evaluation of the studies on 5-year survival and disease-free recurrence in 5 years, according to hepatocarcinoma criteria for liver transplantation. The paper aims to review and analyze 5-year survival and disease-free recurrence based on hepatocarcinoma criteria for liver transplantation. It systematically examines and summarizes distribution characteristics and research frontiers through bibliometric analysis. A bibliographic search was implemented in PubMed/Medline, Clinical Key, Science Direct and Index Medicus with MESH terms, from the year 1996-2022. Patients selected for transplantation using the Metroticket 2.0 (MT2) criteria had the highest overall survival along with patients selected for transplantation using the Milan Criteria had the best 5-year disease-free recurrence. The Metroticket 2.0 criteria (MT2) and Milan Criteria (MC) have shown the most favorable post-transplant outcomes for patients with hepatocellular carcinoma (HCC). However, MC demonstrated the best 5-year disease-free recurrence rate, underscoring the significance of taking into account tumor morphology and biology when determining the eligibility of HCC patients for liver transplantation. The distribution characteristics and research frontiers by bibliometrics concerning prognostic role of selection criteria for liver transplantation in patients with hepatocellular carcinoma the collaborations are sufficient to reach a consensus that the Milan criteria are the best criteria.

Research Square 2024-02-06 Preprint (No Snippets API) Tian C, Guo Y, Guan H, Ma K, Hao R, Zhu W, Zhao J, Li M.
Show Full Abstract

<title>Abstract</title> <p>BACKGROUND Acute respiratory distress syndrome (ARDS) is a common acute clinical syndrome of the respiratory system with a high mortality rate and difficult prognosis.COVID-19 is a serious respiratory infectious disease caused by coronaviruses in a global pandemic. Some studies have suggested a possible association between COVID-19 and ARDS, but few studies have investigated the mechanism of interaction between them. METHODS Microarray data of ARDS (GSE32707 and GSE66890) and COVID-19 (GSE213313) were downloaded from the GEO database and searched for common differential genes for enrichment analysis.WGCNA was used to identify co-expression modules and genes associated with ARDS and COVID-19. RF and LASSO were performed for candidate gene identification. Machine learning XGBoost improved the diagnosis of hub genes in ARDS and COVID-19. The degree of immune cell infiltration in ARDS and COVID-19 samples was assessed using the CIBERSORT algorithm, and the relationship between hub genes and infiltrating immune cells was investigated. Changes in pathway activity per cell were visualized using Seurat standard flow down clustering (seurat) to visualize peripheral blood mononuclear cell (PBMC) single-cell RNA sequencing (scRNA-seq) data from patients with sepsis-combined ARDS and patients with sepsis alone. RESULTS Limma difference analysis identified 314 up-regulated genes and 241 down-regulated genes in ARDS and COVID-19.WGCNA identified the purple-red co-expression module as the core module of ARDS and COVID-19. Five candidate genes, namely HIST1H2BK, TCF4, OLFM4, KIF14 and HK1, were screened using two machine learning algorithms, RF and LASSO. XGBoost constructed diagnostic models to evaluate the hub genes with high diagnostic efficacy in ARDS and COVID-19. Single-cell sequencing revealed the presence of alterations in five immune subpopulations, including monocytes, B cells, T cells, NK cells and platelets, with high expression levels and cellular occupancy of TCF4 and HK1, which are involved in oxidative reactions.</p>

Also flagged:mineralbone diseasedevelopmental problemsmedetomidinebutorphanolmineralization
Journal Article 2024-02-05 No Snippets Sogawa T, Yamaguchi F, Misumi K, Fujiki M.
Show Full Abstract

This study was performed to evaluate cortical bone strength in dogs using a quantitative ultrasound measurement device. In this study, 16 clinically healthy dogs with no lameness underwent measurement of the ultrasound propagation velocity of cortical bone (namely, speed of sound [SOS]) at the radius and tibia. Additionally, computed tomography examination with a calibration phantom was performed in 10 dogs. We calculated the bone mineral density (BMD) and Young's modulus from the computed tomography data using bone strength evaluation software. SOS, BMD, and Young's modulus were statistically compared between the radius and tibia. In addition, we examined the correlation between SOS and BMD and between SOS and Young's modulus. We also examined the correlation between SOS and age in the 13 dogs whose age was known. BMD and Young's modulus were not significantly different between the radius and tibia, but SOS was significantly different (P<0.05). Moreover, SOS and BMD showed a positive correlation in both radius and tibia. Similarly, SOS and Young's modulus showed a positive correlation. In addition, SOS and age showed a strong positive correlation (radius: r=0.77, P<0.05, tibia: r=0.83, P<0.05). Our finding that SOS of the radius and tibia cortical bone was correlated with BMD and Young's modulus indicates that quantitative ultrasound can be useful for evaluating cortical bone strength in dogs.

HFE
Also flagged:AFnonalcoholic fatty liver diseaseNAFLDviral hepatitisliver diseasemetabolic syndrome
Journal Article 2024-02-05 ✓ 1 Snippet Sterling RK, Vilar-Gomez E, Wilson LA, Loomba R, Gawrieh S, Price J, Naggie S, Lake JE, Heath S, Tonascia J, Sulkowski M, Chalasani N, HIV-NASH CRN.
In-Text Gene Mentions

hemochromatosis

Show Full Abstract

<h4>Introduction</h4>Steatotic liver disease is common in people with HIV (PWH). Identifying those with advanced fibrosis (AF, bridging fibrosis or cirrhosis), F3-4, is important. We aimed to examine the performance of FIB-4 and nonalcoholic fatty liver disease (NAFLD) fibrosis score (NFS) in PWH to identify those with AF assessed by liver stiffness measurement (LSM).<h4>Methods</h4>We prospectively collected data on adults participating in 2 National Institute of Health-sponsored HIV NAFLD networks. All had HIV on antiretroviral therapy (ART) ≥6 months with HIV RNA <200 copies/mL. Those with viral hepatitis, other liver disease, excessive alcohol use, or hepatic decompensation were excluded. Vibration-controlled transient elastrography for LSM was performed, and AF defined as ≥11 kPa was compared with FIB-4 and NFS at predefined thresholds (<1.3 and >2.67 for FIB-4 and <-1.455 and >0.675 for NFS).<h4>Results</h4>A total of 1,065 participants were analyzed: mean age 51.6 years, 74% male, 28% White, 46% Black, 22% Hispanic, with 34% overweight (body mass index 25-29 kg/m 2 ) and 43% obese (body mass index ≥30 kg/m 2 ). Features of the metabolic syndrome were common: hyperlipidemia 35%, type 2 diabetes 17%, and hypertension 48%. The median CD4 + T-cell count was 666 cells/mm 3 , 74% had undetectable HIV RNA, and duration of HIV-1 was 17 years with most taking a nucleoside reverse transcriptase inhibitor (92%) and an integrase inhibitor (83%). The mean LSM was 6.3 kPa, and 6.3% had AF. The area under the receiver characteristic curve for FIB-4 and NFS to identify AF were 0.70 and 0.75, respectively. While both had high negative predictive values (97%-98%), the sensitivity at low thresholds and specificity at high thresholds were 64% and 97% for FIB-4 and 80% and 96% for NFS, respectively. Neither FIB-4 nor NFS at either threshold had good positive predictive value to detect AF.<h4>Discussion</h4>FIB-4 and NFS have excellent specificity and negative predictive value for detecting AF, and thus can be used as screening tools in PWH to exclude those with AF who do not need further testing (LSM) or referral to hepatologist.

DCC
Also flagged:neurodevelopmental disorderRAD51NTN1ARHGEF7DNAL4binding
Journal Article 2024-02-05 ✓ 5 Snippets Collins Hutchinson ML, St-Onge J, Schlienger S, Boudrahem-Addour N, Mougharbel L, Michaud JF, Lloyd C, Bruneau E, Roux C, Sahly AN, Osterman B, Myers KA, Rouleau GA, Jimenez Cruz DA, Rivière JB, Accogli A, Charron F, Srour M.
In-Text Gene Mentions

…with CMM, namelyDCC, RAD51, NTN1, ARHGEF7,…

…of three missenseDCCvariants on binding…

…on binding betweenDCCand Netrin-1 in…

…causal gene wasDCC, responsible for 28%…

…of CMM inDCCpathogenic variant carriers…

Show Full Abstract

<h4>Background</h4>Congenital mirror movements (CMM) is a rare neurodevelopmental disorder characterized by involuntary movements from one side of the body that mirror voluntary movements on the opposite side. To date, five genes have been associated with CMM, namely DCC, RAD51, NTN1, ARHGEF7, and DNAL4.<h4>Objective</h4>The aim of this study is to characterize the genetic landscape of CMM in a large group of 80 affected individuals.<h4>Methods</h4>We screened 80 individuals with CMM from 43 families for pathogenic variants in CMM genes. In large CMM families, we tested for presence of pathogenic variants in multiple affected and unaffected individuals. In addition, we evaluated the impact of three missense DCC variants on binding between DCC and Netrin-1 in vitro.<h4>Results</h4>Causal pathogenic/likely pathogenic variants were found in 35% of probands overall, and 70% with familial CMM. The most common causal gene was DCC, responsible for 28% of CMM probands and 80% of solved cases. RAD51, NTN1, and ARHGEF7 were rare causes of CMM, responsible for 2% each. Penetrance of CMM in DCC pathogenic variant carriers was 68% and higher in males than females (74% vs. 54%). The three tested missense variants (p.Ile164Thr; p.Asn176Ser; and p.Arg1343His) bind Netrin-1 similarly to wild type DCC.<h4>Conclusions</h4>A genetic etiology can be identified in one third of CMM individuals, with DCC being the most common gene involved. Two thirds of CMM individuals were unsolved, highlighting that CMM is genetically heterogeneous and other CMM genes are yet to be discovered. © 2024 The Authors. Movement Disorders published by Wiley Periodicals LLC on behalf of International Parkinson and Movement Disorder Society.

DCC
Also flagged:colorectal cancercancerobesityoncogenesRat Sarcoma Viral Oncogene HomologKRAS
Journal Article 2024-02-05 ✓ 2 Snippets Ren J, Han B, Feng P, Shao G, Chang Y.
In-Text Gene Mentions

Some are tumor suppressor genes, such as Phosphatase and Tensin Homolog (PTEN) and Deleted in Colorectal Cancer (DCC), which are very low expressed in CRC, and their mutation and inactivation can stimulate tumor growth (Shen et al. 2021).

…in Colorectal Cancer (DCC), which are very…

Show Full Abstract

This study is aimed at investigating the roles of Toll-like receptor 4 (TLR4) and microRNA-7 (miR-7) in colorectal cancer (CRC) development and progression. We assessed TLR4 and miR-7 expression in CRC cells and tissues using reverse transcription-quantitative polymerase chain reaction. The relationship between miR-7 and TLR4 was analyzed through dual luciferase reporter assays. MTT, wound healing, and cell invasion assays were conducted to examine the effects of TLR4 and miR-7 on CRC cell proliferation, migration, and invasion. Western blotting was used to explore the involvement of the TRAF6/NF-κB signaling pathway. miR-7 was underexpressed in CRC, while TLR4 levels were increased. miR-7 negatively regulated TLR4 expression and its knockdown enhanced CRC cell proliferation, migration, and invasion. TLR4 knockdown had the opposite effects. The TRAF6/NF-κB pathway was linked to TLR4's role in tumor progression. miR-7 might inhibit TRAF6/NF-κB target a signaling pathway of TLR4 and promote CRC occurrence. miR-7 may therefore be used as a sensitive biomarker in CRC patients.

OLFM4
Also flagged:trimethylaminefarnesoid X receptorcolorectal cancerApcintestinal adenomatumor
Journal Article 2024-02-05 ✓ 1 Snippet Zhang W, Qin X, Zhang K, Ma J, Li M, Jin G, Liu X, Wang S, Wang B, Wu J, Liu T, Zhong W, Cao H.
In-Text Gene Mentions

Olfm4

Show Full Abstract

<h4>Purpose</h4>Microbial dysbiosis is considered as a hallmark of colorectal cancer (CRC). Trimethylamine-N-oxide (TMAO) as a gut microbiota-dependent metabolite has recently been implicated in CRC development. Nevertheless, evidence relating TMAO to intestinal carcinogenesis remains largely unexplored. Herein, we aimed to examine the crucial role of TMAO in CRC progression.<h4>Methods</h4>Apc<sup>min/+</sup> mice were treated with TMAO or sterile PBS for 14 weeks. Intestinal tissues were isolated to evaluate the effects of TMAO on the malignant transformation of intestinal adenoma. The gut microbiota of mouse feces was detected by 16S rRNA sequencing analysis. HCT-116 cells were used to provide further evidence of TMAO on the progression of CRC.<h4>Results</h4>TMAO administration increased tumor cell and stem cell proliferation, and decreased apoptosis, accompanied by DNA damage and gut barrier impairment. Gut microbiota analysis revealed that TMAO induced changes in the intestinal microbial community structure, manifested as reduced beneficial bacteria. Mechanistically, TMAO bound to farnesoid X receptor (FXR), thereby inhibiting the FXR-fibroblast growth factor 15 (FGF15) axis and activating the Wnt/β-catenin signaling pathway, whereas the FXR agonist GW4064 could blunt TMAO-induced Wnt/β-catenin pathway activation.<h4>Conclusion</h4>The microbial metabolite TMAO can enhance intestinal carcinogenesis by inhibiting the FXR-FGF15 pathway.

DCC
Also flagged:head and neck cancerhead and neck squamous cell carcinomaHNSCCmethylationhistonemodifications
Journal Article 2024-02-05 ✓ 1 Snippet Lim I, Tan J, Alam A, Idrees M, Brenan PA, Coletta RD, Kujan O.
In-Text Gene Mentions

…curve values: TIPM3,DCC, DAPK, SEPT9, SHOX9,…

Show Full Abstract

<h4>Background</h4>Aberrant epigenetic modifications significantly develop and progress human malignancies including head and neck squamous cell carcinoma (HNSCC). Taking into account issues of late diagnosis and poor prognosis associated with HNSCC, this systematic review is designed to provide an up-to-date insight of epigenetic changes in the management of HNSCC.<h4>Methods</h4>All studies that assessed the diagnostic and prognostic utilities of epigenetic changes (DNA methylation and histone modifications) among patients diagnosed with HNSCC or oral potentially malignant disorders (OPMDs) were considered for inclusion till June 2023. Pre-defined Medical Subject Headings terms were used to search Web of Science, Pubmed, Scopus and Embase Ovid databases.<h4>Results</h4>Twenty-five studies were deemed eligible for inclusion with a total number of 3790 samples (2123 HNSCCs, 334 OPMDs and 1333 as controls). DNA methylation was investigated in 18 studies while the role of histone modifications was assessed in seven studies. The most investigated biomarkers among the studies were H3, DAPK and TIMP3. The diagnostic accuracy of the epigenetic biomarkers in detecting HNSCC was assessed in eight studies where the following biomarkers showed the highest area under the curve values: TIPM3, DCC, DAPK, SEPT9, SHOX9, HOXA9 and TRH. None of the studies assessed the predictability of the epigenetic biomarkers in HNSCC and OPMDs.<h4>Conclusion</h4>Although initial promising results were seen using the epigenetic biomarkers in the early detection of HNSCC, the limited number of patients and the absence of well-designed longitudinal studies limit the clinical applicability of the outcomes.

RABGAP1L
Also flagged:breast cancercancerbrain metastasesmetastatic tumorstumorCCR5
Journal Article 2024-02-05 ✓ 1 Snippet Zhou H, He X, Huang J, Zhong Y, Zhang L, Ao X, Zhao H, Hu S, Li H, Huang J, Huang H, Liang H.
In-Text Gene Mentions

…also represented pDC (RABGAP1L, SLC15A4).…

Show Full Abstract

<h4>Background</h4>Breast cancer has the highest incidence rate of cancer worldwide, and brain metastases (BrM) are among the most malignant cases. While some patients have benefited from immune checkpoint inhibitors (ICIs), the complex anatomical structure of the brain and the heterogeneity of metastatic tumors have made it difficult to characterize the tumor immune microenvironment (TME) of metastatic tumors.<h4>Methods</h4>To address this, we used single-cell RNA sequencing (scRNA-seq) to analyze immune cells in the cerebrospinal fluid (CSF) of BrM patients with breast cancer, thereby providing a comprehensive view of the immune microenvironment landscape of BrM.<h4>Results</h4>Based on canonical marker genes, we identified nine cell types, and further identified their subtypes through differential expression gene (DEG) analysis. We compared the changes in cells and functions in the immune microenvironment of patients with different prognoses. Our analysis revealed a series of genes that promote tumor immune function (CCR5, LYZ, IGKC, MS4A1, etc.) and inhibit tumor immune function (SCGB2A2, CD24, etc.).<h4>Conclusions</h4>The scRNA-seq in CSF provides a noninvasive method to describe the TME of breast cancer patients and guide immunotherapy.

OLFM4
Also flagged:SLEgoblet cell differentiationsystemic lupus erythematosusmitochondrialinterferonautoimmune diseases
Journal Article 2024-02-05 ✓ 2 Snippets Hensel IV, Éliás S, Steinhauer M, Stoll B, Benfatto S, Merkt W, Krienke S, Lorenz HM, Haas J, Wildemann B, Resnik-Docampo M.
In-Text Gene Mentions

…cell markers LGR5,OLFM4, RGMB, and SMOC2…

…markers SMOC2 andOLFM4were significantly downregulat…

Show Full Abstract

Human intestinal epithelial cells are the interface between luminal content and basally residing immune cells. They form a tight monolayer that constantly secretes mucus creating a multilayered protective barrier. Alterations in this barrier can lead to increased permeability which is common in systemic lupus erythematosus (SLE) patients. However, it remains unexplored how the barrier is affected. Here, we present an in vitro model specifically designed to examine the effects of SLE on epithelial cells. We utilize human colon organoids that are stimulated with serum from SLE patients. Combining transcriptomic with functional analyses revealed that SLE serum induced an expression profile marked by a reduction of goblet cell markers and changed mucus composition. In addition, organoids exhibited imbalanced cellular composition along with enhanced permeability, altered mitochondrial function, and an interferon gene signature. Similarly, transcriptomic analysis of SLE colon biopsies revealed a downregulation of secretory markers. Our work uncovers a crucial connection between SLE and intestinal homeostasis that might be promoted in vivo through the blood, offering insights into the causal connection of barrier dysfunction and autoimmune diseases.

SUDS3
Also flagged:HDAChistone acetyltransferaseshistone deacetylasesHDACsgene expressioncancer
Journal Article 2024-02-05 ✓ 1 Snippet Shao R, Suzuki T, Suyama M, Tsukada Y.
In-Text Gene Mentions

…In mammals, zinc-dependent classical HDACsclassical HDACs can…

Show Full Abstract

<h4>Background</h4>Histone acetylation, which is regulated by histone acetyltransferases (HATs) and histone deacetylases (HDACs), plays a crucial role in the control of gene expression. HDAC inhibitors (HDACi) have shown potential in cancer therapy; however, the specific roles of HDACs in early embryos remain unclear. Moreover, although some pan-HDACi have been used to maintain cellular undifferentiated states in early embryos, the specific mechanisms underlying their effects remain unknown. Thus, there remains a significant knowledge gap regarding the application of selective HDACi in early embryos.<h4>Results</h4>To address this gap, we treated early embryos with two selective HDACi (MGCD0103 and T247). Subsequently, we collected and analyzed their transcriptome data at different developmental stages. Our findings unveiled a significant effect of HDACi treatment during the crucial 2-cell stage of zygotes, leading to a delay in embryonic development after T247 and an arrest at 2-cell stage after MGCD0103 administration. Furthermore, we elucidated the regulatory targets underlying this arrested embryonic development, which pinpointed the G2/M phase as the potential period of embryonic development arrest caused by MGCD0103. Moreover, our investigation provided a comprehensive profile of the biological processes that are affected by HDACi, with their main effects being predominantly localized in four aspects of zygotic gene activation (ZGA): RNA splicing, cell cycle regulation, autophagy, and transcription factor regulation. By exploring the transcriptional regulation and epigenetic features of the genes affected by HDACi, we made inferences regarding the potential main pathways via which HDACs affect gene expression in early embryos. Notably, Hdac7 exhibited a distinct response, highlighting its potential as a key player in early embryonic development.<h4>Conclusions</h4>Our study conducted a comprehensive analysis of the effects of HDACi on early embryonic development at the transcriptional level. The results demonstrated that HDACi significantly affected ZGA in embryos, elucidated the distinct actions of various selective HDACi, and identified specific biological pathways and mechanisms via which these inhibitors modulated early embryonic development.

Also flagged:breast cancertumortumorsbonecancertranslational
Journal Article 2024-02-05 No Snippets Kolahi Azar H, Gharibshahian M, Rostami M, Mansouri V, Sabouri L, Beheshtizadeh N, Rezaei N.
Show Full Abstract

Bone metastasis is considered as a considerable challenge for breast cancer patients. Various in vitro and in vivo models have been developed to examine this occurrence. In vitro models are employed to simulate the intricate tumor microenvironment, investigate the interplay between cells and their adjacent microenvironment, and evaluate the effectiveness of therapeutic interventions for tumors. The endeavor to replicate the latency period of bone metastasis in animal models has presented a challenge, primarily due to the necessity of primary tumor removal and the presence of multiple potential metastatic sites.The utilization of novel bone metastasis models, including three-dimensional (3D) models, has been proposed as a promising approach to overcome the constraints associated with conventional 2D and animal models. However, existing 3D models are limited by various factors, such as irregular cellular proliferation, autofluorescence, and changes in genetic and epigenetic expression. The imperative for the advancement of future applications of 3D models lies in their standardization and automation. The utilization of artificial intelligence exhibits the capability to predict cellular behavior through the examination of substrate materials' chemical composition, geometry, and mechanical performance. The implementation of these algorithms possesses the capability to predict the progression and proliferation of cancer. This paper reviewed the mechanisms of bone metastasis following primary breast cancer. Current models of breast cancer bone metastasis, along with their challenges, as well as the future perspectives of using these models for translational drug development, were discussed.

Also flagged:chromosomemajor histocompatibility complexchromosomesMHCNK cell receptor-likeBTN
Journal Article 2024-02-05 No Snippets Hu J, Song L, Ning M, Niu X, Han M, Gao C, Feng X, Cai H, Li T, Li F, Li H, Gong D, Song W, Liu L, Pu J, Liu J, Smith J, Sun H, Huang Y.
Show Full Abstract

<h4>Background</h4>The duck (Anas platyrhynchos) is one of the principal natural hosts of influenza A virus (IAV), harbors almost all subtypes of IAVs and resists to many IAVs which cause extreme virulence in chicken and human. However, the response of duck's adaptive immune system to IAV infection is poorly characterized due to lack of a detailed gene map of the major histocompatibility complex (MHC).<h4>Results</h4>We herein reported a chromosome-scale Beijing duck assembly by integrating Nanopore, Bionano, and Hi-C data. This new reference genome SKLA1.0 covers 40 chromosomes, improves the contig N50 of the previous duck assembly with highest contiguity (ZJU1.0) of more than a 5.79-fold, surpasses the chicken and zebra finch references in sequence contiguity and contains a complete genomic map of the MHC. Our 3D MHC genomic map demonstrated that gene family arrangement in this region was primordial; however, families such as AnplMHCI, AnplMHCIIβ, AnplDMB, NKRL (NK cell receptor-like genes) and BTN underwent gene expansion events making this area complex. These gene families are distributed in two TADs and genes sharing the same TAD may work in a co-regulated model.<h4>Conclusions</h4>These observations supported the hypothesis that duck's adaptive immunity had been optimized with expanded and diversified key immune genes which might help duck to combat influenza virus. This work provided a high-quality Beijing duck genome for biological research and shed light on new strategies for AIV control.

HTT
Also flagged:GOLGA7NRASGolgimembranehematological malignanciessolid tumors
Journal Article 2024-02-05 ✓ 1 Snippet Liu C, Jiao B, Wang P, Zhang B, Gao J, Li D, Xie X, Yao Y, Yan L, Qin Z, Liu P, Ren R.
In-Text Gene Mentions

…GOLGA7B, SelK, andHTT, have been reported…

Show Full Abstract

NRAS mutations are most frequently observed in hematological malignancies and are also common in some solid tumors such as melanoma and colon cancer. Despite its pivotal role in oncogenesis, no effective therapies targeting NRAS has been developed. Targeting NRAS localization to the plasma membrane (PM) is a promising strategy for cancer therapy, as its signaling requires PM localization. However, the process governing NRAS translocation from the Golgi apparatus to the PM after lipid modification remains elusive. This study identifies GOLGA7 as a crucial factor controlling NRAS' PM translocation, demonstrating that its depletion blocks NRAS, but not HRAS, KRAS4A and KRAS4B, translocating to PM. GOLGA7 is known to stabilize the palmitoyltransferase ZDHHC9 for NRAS and HRAS palmitoylation, but we found that GOLGA7 depletion does not affect NRAS' palmitoylation level. Further studies show that loss of GOLGA7 disrupts NRAS anterograde trafficking, leading to its cis-Golgi accumulation. Remarkably, depleting GOLGA7 effectively inhibits cell proliferation in multiple NRAS-mutant cancer cell lines and attenuates NRAS<sup>G12D</sup>-induced oncogenic transformation in vivo. These findings elucidate a specific intracellular trafficking route for NRAS under GOLGA7 regulation, highlighting GOLGA7 as a promising therapeutic target for NRAS-driven cancers.

Also flagged:androgen receptorGATA3tumorestrogen receptorbreast cancerbreast cancers
Journal Article 2024-02-05 No Snippets Hosseinzadeh L, Kikhtyak Z, Laven-Law G, Pederson SM, Puiu CG, D'Santos CS, Lim E, Carroll JS, Tilley WD, Dwyer AR, Hickey TE.
Show Full Abstract

<h4>Background</h4>The androgen receptor (AR) is a tumor suppressor in estrogen receptor (ER) positive breast cancer, a role sustained in some ER negative breast cancers. Key factors dictating AR genomic activity in a breast context are largely unknown. Herein, we employ an unbiased chromatin immunoprecipitation-based proteomic technique to identify endogenous AR interacting co-regulatory proteins in ER positive and negative models of breast cancer to gain new insight into mechanisms of AR signaling in this disease.<h4>Results</h4>The DNA-binding factor GATA3 is identified and validated as a novel AR interacting protein in breast cancer cells irrespective of ER status. AR activation by the natural ligand 5α-dihydrotestosterone (DHT) increases nuclear AR-GATA3 interactions, resulting in AR-dependent enrichment of GATA3 chromatin binding at a sub-set of genomic loci. Silencing GATA3 reduces but does not prevent AR DNA binding and transactivation of genes associated with AR/GATA3 co-occupied loci, indicating a co-regulatory role for GATA3 in AR signaling. DHT-induced AR/GATA3 binding coincides with upregulation of luminal differentiation genes, including EHF and KDM4B, established master regulators of a breast epithelial cell lineage. These findings are validated in a patient-derived xenograft model of breast cancer. Interaction between AR and GATA3 is also associated with AR-mediated growth inhibition in ER positive and ER negative breast cancer.<h4>Conclusions</h4>AR and GATA3 interact to transcriptionally regulate luminal epithelial cell differentiation in breast cancer regardless of ER status. This interaction facilitates the tumor suppressor function of AR and mechanistically explains why AR expression is associated with less proliferative, more differentiated breast tumors and better overall survival in breast cancer.

TNFSF4
Also flagged:lung adenocarcinomaLUADdeathtumorglucosemetabolism
Journal Article 2024-02-05 ✓ 1 Snippet Wu B, Zhang X, Feng N, Guo Z, Gao L, Wan Z, Zhang W.
In-Text Gene Mentions

…CD70, CD276 andTNFSF4in the high-risk…

Show Full Abstract

<h4>Background</h4>Methods for predicting the outcome of lung adenocarcinoma (LUAD) in the clinic are limited. Anoikis is an important route to programmed cell death in LUAD, and the prognostic value of a model constructed with anoikis-related lncRNAs (ARlncRNAs) in LUAD is unclear.<h4>Methods</h4>Transcriptome and basic information for LUAD patients was obtained from the Cancer Genome Atlas. Coexpression and Cox regression analyses were utilized to identify prognostically significant ARlncRNAs and construct a prognostic signature. Furthermore, the signature was combined with clinical characteristics to create a nomogram. Finally, we performed principal component, enrichment, tumor mutation burden (TMB), tumor microenvironment (TME) and drug sensitivity analyses to evaluate the basic research and clinical merit of the signature.<h4>Results</h4>The prognostic signature developed with eleven ARlncRNAs can accurately predict that high-risk group patients have a worse prognosis, as proven by the receiver operating characteristic (ROC) curve (AUC: 0.718). Independent prognostic analyses indicated that the risk score is a significant independent prognostic element for LUAD (P<0.001). In the high-risk group, enrichment analysis demonstrated that glucose metabolism and DNA replication were the main enrichment pathways. TMB analysis indicated that the high-risk group had a high TMB (P<0.05). Drug sensitivity analyses can recognize drugs that are sensitive to different risk groups. Finally, 11 ARlncRNAs of this signature were verified by RT-qPCR analysis.<h4>Conclusions</h4>A novel prognostic signature developed with 11 ARlncRNAs can accurately predict the OS of LUAD patients and offer clinical guidance value for immunotherapy and chemotherapy treatment.

Also flagged:extracellularvesiclesdiabetesCST6CD55HBA1
Journal Article 2024-02-05 No Snippets Arredondo-Damián JG, Martínez-Soto JM, Molina-Pelayo FA, Soto-Guzmán JA, Castro-Sánchez L, López-Soto LF, Candia-Plata MDC.
Show Full Abstract

<h4>Background</h4>Type 2 diabetes (T2D) is a complex metabolic ailment marked by a global high prevalence and significant attention in primary healthcare settings due to its elevated morbidity and mortality rates. The pathophysiological mechanisms underlying the onset and progression of this disease remain subjects of ongoing investigation. Recent evidence underscores the pivotal role of the intricate intercellular communication network, wherein cell-derived vesicles, commonly referred to as extracellular vesicles (EVs), emerge as dynamic regulators of diabetes-related complications. Given that the protein cargo carried by EVs is contingent upon the metabolic conditions of the originating cells, particular proteins may serve as informative indicators for the risk of activating or inhibiting signaling pathways crucial to the progression of T2D complications.<h4>Methods</h4>In this study, we conducted a systematic review to analyze the published evidence on the proteome of EVs from the plasma or serum of patients with T2D, both with and without complications (PROSPERO: CRD42023431464).<h4>Results</h4>Nine eligible articles were systematically identified from the databases, and the proteins featured in these articles underwent Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway enrichment analysis. We identified changes in the level of 426 proteins, with CST6, CD55, HBA1, S100A8, and S100A9 reported to have high levels, while FGL1 exhibited low levels.<h4>Conclusion</h4>These proteins are implicated in pathophysiological mechanisms such as inflammation, complement, and platelet activation, suggesting their potential as risk markers for T2D development and progression. Further studies are required to explore this topic in greater detail.

SERPINC1
Also flagged:heparinextra-hepatic portal venous obstructionportal cavernomahypersplenismesophagogastric varicesportal hypertension
Journal Article 2024-02-05 ✓ 1 Snippet Zhang J, Li L.
In-Text Gene Mentions

…and anti-thrombin III (ATIII), routine blood test,…

Show Full Abstract

<h4>Purpose</h4>Rex shunt is an optimal surgery for the treatment of extra-hepatic portal venous obstruction (EHPVO) in children. Anticoagulant therapy has been used to keep the patency of the bypass vein in the Rex shunt. This study was to investigate the effectiveness of anticoagulant therapy using heparin combined with Plavix in improving the prognosis and shunt patency of Rex shunt.<h4>Methods</h4>From January 2010 to September 2019, 51 children with EHPVO underwent a portal cavernoma- Rex shunt. Based on whether using the anticoagulant therapy after the Rex shunt, all patients were divided into two groups: the anticoagulant group and the non-anticoagulant group. The diameter and flow velocity of the bypass vein were measured by the post-operative ultrasound, which was used to calculate the flow volume of the bypass vein (FV) and standard portal venous flow (SPVF). The bypass venous flow index (BVFI) was used to evaluate the ability of portal blood into the liver through the bypass vein after the Rex shunt, which was a ratio of FV to SPVF. The incidence of post-operative re-bleeding, the postoperative patency rate of the bypass vein, the remission rate of postoperative hypersplenism, the remission rate of postoperative esophagogastric varices and the BVFI were compared between the two groups.<h4>Results</h4>Of the 51 patients, 12 patients in the anticoagulant group were treated with heparin combined with Plavix after Rex shunt; 39 patients in the non-anticoagulant group were not treated with any anticoagulant therapy. 8 of 51 patients suffered from postoperative re-bleeding, of whom 6 patients with thrombosis of the bypass vein and 2 patients with anastomotic stenosis of the bypass vein. All 8 patients with re-bleeding belonged to the non-anticoagulant group. The remission rate of hypersplenism was no significant difference between the two groups after surgery (91% vs. 58%, <i>P</i> = 0.100). However, 3 patients without hypersplenism before surgery suffered from hypersplenism after surgery, who belonged to the non-anticoagulant group. There was no significant difference in the remission rate of esophagogastric varices (33% vs. 46%, <i>P</i> = 1.000). The BVFI of the anticoagulant group was significantly higher than that of the non-anticoagulant group (5.71 ± 5.89 vs. 1.1 ± 1.52, <i>P</i> = 0.003).<h4>Conclusions</h4>Anticoagulant therapy using heparin combined with Plavix plays an important role in maintaining the patency of the bypass vein, which improved the portal blood flow into the liver through the bypass vein after the Rex shunt.

OLFM4
Also flagged:interleukin-23 receptorIL-23colorectal cancerIL-23 receptorIL-23Rcolitis-associated cancer
Journal Article 2024-02-05 ✓ 3 Snippets Jacobse J, Pilat JM, Li J, Brown RE, Kwag A, Buendia MA, Choksi YA, Washington MK, Williams CS, Markham NO, Short SP, Goettel JA.
In-Text Gene Mentions

IHC for OLFM4 was done by FR with the following protocol: (1) Antigen Retrieval: Citrate buffer pH 6.0, decloaking chamber 105°C for 15 minutes, 10 minute bench cool down; (2) Peroxidase Block: 0.03% H202 with sodium azide, 5 minute incubation; (3) Primary Antibody (Cell Signaling, 39141, Massachusetts): 1:500 dilution, overnight incubation; (4) Detection: Dako (K4003) Envision + HRP Labelled Polymer, 30 minute incubation; (5) Chromogen: DAB+, 5 minute incubation.

…IHC forOLFM4was done by…

…Frank Revetta performedOLFM4IHC.…

Show Full Abstract

<h4>Introduction</h4>The pro-inflammatory cytokine interleukin-23 (IL-23) has been implicated in colorectal cancer (CRC). Yet, the cell-specific contributions of IL-23 receptor (IL-23R) signaling in CRC remain unknown. One of the cell types that highly expresses IL-23R are colonic regulatory T cells (Treg cells). The aim of this study was to define the contribution of Treg cell-specific IL-23R signaling in sporadic and inflammation-associated CRC.<h4>Methods</h4>In mice, the role of IL-23R in Treg cells in colitis-associated cancer (CAC) was investigated using azoxymethane/dextran sodium sulphate in wild-type Treg cell reporter mice (WT, <i>Foxp3</i> <sup>YFP-iCre</sup>), and mice harboring a Treg cell-specific deletion of IL-23 (<i>Il23r</i> <sup>ΔTreg</sup>). The role of IL-23R signaling in Treg cells in sporadic CRC was examined utilizing orthotopic injection of the syngeneic colon cancer cell line MC-38 submucosally into the colon/rectum of mice. The function of macrophages was studied using clodronate. Finally, single-cell RNA-seq of a previously published dataset in human sporadic cancer was reanalyzed to corroborate these findings.<h4>Results</h4>In CAC, <i>Il23r</i> <sup>ΔTreg</sup> mice had increased tumor size and increased dysplasia compared to WT mice that was associated with decreased tumor-infiltrating macrophages. In the sporadic cancer model, <i>Il23r</i> <sup>ΔTreg</sup> mice had increased survival and decreased tumor size compared to WT mice. Additionally, MC-38 tumors of <i>Il23r</i> <sup>ΔTreg</sup> mice exhibited a higher frequency of pro-inflammatory macrophages and IL-17 producing CD4<sup>+</sup> T cells. The decreased tumor size in <i>Il23r</i> <sup>ΔTreg</sup> mice was macrophage-dependent. These data suggest that loss of IL-23R signaling in Treg cells permits IL-17 production by CD4<sup>+</sup> T cells that in turn promotes pro-inflammatory macrophages to clear tumors. Finally, analysis of TCGA data and single-cell RNA-seq analysis of a previously published dataset in human sporadic cancer, revealed that <i>IL23R</i> was highly expressed in CRC compared to other cancers and specifically in tumor-associated Treg cells.<h4>Conclusion</h4>Inflammation in colorectal carcinogenesis differs with respect to the contribution of IL-23R signaling in regulatory T cells.

DCC
Also flagged:tumorangiogenesisneuropeptidesbloodtumorscancer
Journal Article 2024-02-05 ✓ 1 Snippet Shalabi S, Belayachi A, Larrivée B.
In-Text Gene Mentions

- Netrin-1 and Netrin-4 delay the growth of lung, pancreatic and prostate tumors.- Netrin-1 promotes the growth of glioma cells by activating NF-κB signaling via UNC5A.- Netrin-1 is a positive regulator of malignant tumor metastasis by activating YAP signaling.- Netrin-1 induces antiapoptotic effects of acute myeloid leukemia cells through Unc5B.- Loss of netrin-1 receptor DCC is associated with a poor prognosis in patients with colorectal tumors, glioblastoma, and breast carcinoma.- Netrin-1 stimulates tumor progression in breast, cancer and medulloblastoma

Show Full Abstract

Emerging evidence suggests that nerves within the tumor microenvironment play a crucial role in regulating angiogenesis. Neurotransmitters and neuropeptides released by nerves can interact with nearby blood vessels and tumor cells, influencing their behavior and modulating the angiogenic response. Moreover, nerve-derived signals may activate signaling pathways that enhance the production of pro-angiogenic factors within the tumor microenvironment, further supporting blood vessel growth around tumors. The intricate network of communication between neural constituents and the vascular system accentuates the potential of therapeutically targeting neural-mediated pathways as an innovative strategy to modulate tumor angiogenesis and, consequently, neoplastic proliferation. Hereby, we review studies that evaluate the precise molecular interplay and the potential clinical ramifications of manipulating neural elements for the purpose of anti-angiogenic therapeutics within the scope of cancer treatment.

DCC
Also flagged:growth coneaxonsextracellularaxonnetrin-1netrin-1 receptor
Journal Article 2024-02-05 ✓ 5 Snippets Qiu Z, Minegishi T, Aoki D, Abe K, Baba K, Inagaki N.
In-Text Gene Mentions

…Adhesion-clutch betweenDCCand netrin-1 mediates…

…the netrin-1 receptor,DCC, and the adhesive…

DCCserves as an…

…shootin1a interacted withDCC, linking it to…

…retrograde flow andDCCby shootin1 knockout…

Show Full Abstract

The growth cone, a motile structure located at the tip of growing axons, senses extracellular guidance cues and translates them into directional forces that drive axon outgrowth and guidance. Axon guidance directed by chemical cues on the extracellular adhesive substrate is termed haptotaxis. Recent studies reported that netrin-1 on the substrate functions as a haptotactic axon guidance cue. However, the mechanism mediating netrin-1-induced axonal haptotaxis remains unclear. Here, we demonstrate that substrate-bound netrin-1 induces axonal haptotaxis by facilitating physical interactions between the netrin-1 receptor, DCC, and the adhesive substrates. DCC serves as an adhesion receptor for netrin-1. The clutch-linker molecule shootin1a interacted with DCC, linking it to actin filament retrograde flow at the growth cone. Speckle imaging analyses showed that DCC underwent either grip (stop) or retrograde slip on the adhesive substrate. The grip state was more prevalent on netrin-1-coated substrate compared to the control substrate polylysine, thereby transmitting larger traction force on the netrin-1-coated substrate. Furthermore, disruption of the linkage between actin filament retrograde flow and DCC by shootin1 knockout impaired netrin-1-induced axonal haptotaxis. These results suggest that the directional force for netrin-1-induced haptotaxis is exerted on the substrates through the adhesion-clutch between DCC and netrin-1 which occurs asymmetrically within the growth cone.

HTT
Also flagged:neurological disordertaubeta-amyloidAD14-3-3phosphorylation
Journal Article 2024-02-05 ✓ 2 Snippets Abdi G, Jain M, Patil N, Upadhyay B, Vyas N, Dwivedi M, Kaushal RS.
In-Text Gene Mentions

In HD, the binding of mutant HTT to 14-3-3 proteins may contribute to altered cellular signaling pathways, impaired protein homeostasis, and dysregulated neuronal function (Podvin et al., 2022).

HD is a devastating neurological disorder characterized by the aggregation of mutant HTT and progressive neurodegeneration (Rojas et al., 2022).

Show Full Abstract

Alzheimer's disease (AD) affects millions of people worldwide and is a gradually worsening neurodegenerative condition. The accumulation of abnormal proteins, such as tau and beta-amyloid, in the brain is a hallmark of AD pathology. 14-3-3 proteins have been implicated in AD pathology in several ways. One proposed mechanism is that 14-3-3 proteins interact with tau protein and modulate its phosphorylation, aggregation, and toxicity. Tau is a protein associated with microtubules, playing a role in maintaining the structural integrity of neuronal cytoskeleton. However, in the context of Alzheimer's disease (AD), an abnormal increase in its phosphorylation occurs. This leads to the aggregation of tau into neurofibrillary tangles, which is a distinctive feature of this condition. Studies have shown that 14-3-3 proteins can bind to phosphorylated tau and regulate its function and stability. In addition, 14-3-3 proteins have been shown to interact with beta-amyloid (Aβ), the primary component of amyloid plaques in AD. 14-3-3 proteins can regulate the clearance of Aβ through the lysosomal degradation pathway by interacting with the lysosomal membrane protein LAMP2A. Dysfunction of lysosomal degradation pathway is thought to contribute to the accumulation of Aβ in the brain and the progression of AD. Furthermore, 14-3-3 proteins have been found to be downregulated in the brains of AD patients, suggesting that their dysregulation may contribute to AD pathology. For example, decreased levels of 14-3-3 proteins in cerebrospinal fluid have been suggested as a biomarker for AD. Overall, these findings suggest that 14-3-3 proteins may play an important role in AD pathology and may represent a potential therapeutic target for the disease. However, further research is needed to fully understand the mechanisms underlying the involvement of 14-3-3 proteins in AD and to explore their potential as a therapeutic target.

SOX6
Also flagged:glioblastomamalignant tumor of thegene expressionGBaxonsvesicular GABA transporter
Journal Article 2024-02-05 ✓ 3 Snippets Fan Q, Wang H, Gu T, Liu H, Deng P, Li B, Yang H, Mao Y, Shao Z.
In-Text Gene Mentions

…P2(Rb,1:1000), PAX6(Rb,1:300),SOX6(Rb,1:1000), NKX2.1(Mouse,1:10…

…Additionally,SOX6, which regulates forebrain…

…PAX6, NKX2.1, andSOX6observed in the…

Show Full Abstract

Glioblastoma is a highly aggressive malignant tumor of the central nervous system, but the interaction between glioblastoma and different types of neurons remains unclear. Here, we established a co-culture model <i>in vitro</i> using 3D printed molds with microchannels, in which glioblastoma organoids (GB), dorsal forebrain organoids (DO, mainly composed of excitatory neurons), and ventral forebrain organoids (VO, mainly composed of inhibitory neurons) were assembled. Our results indicate that DO has a greater impact on altered gene expression profiles of GB, resulting in increased invasive potential. GB cells preferentially invaded DO along axons, whereas this phenomenon was not observed in VO. Furthermore, GB cells selectively inhibited neurite outgrowth in DOs and reduced the expression of the vesicular GABA transporter (VGAT), leading to neuronal hyperexcitability. By revealing how glioblastoma interacts with brain cells, our study provides a more comprehensive understanding of this disease.

PRDX6
Also flagged:testicular disorderspeptidespeptidehomingproteaseBSA
Journal Article 2024-02-05 ✓ 1 Snippet Jirwankar Y, Nair A, Marathe S, Dighe V.
In-Text Gene Mentions

PRDX6

Show Full Abstract

Conventional drug delivery methods to treat testicular disorders face various challenges, which could be circumvented by using targeted drug delivery. Testicular cell targeting ligands, such as Leydig cell homing peptides, would be an excellent choice to achieve the targeted delivery of drugs to the testis. In this study, Leydig cell homing peptides (LCHPs), LCHP1 and LCHP2, were identified via in vitro<i>,</i> followed by in vivo biopanning of a phage display peptide library and next-generation sequencing. Both of the LCHPs were validated in vitro for their specific Leydig cell and in vivo testis targeting potential. Furthermore, molecular targets of the LCHP1 and LCHP2 were identified using affinity purification mass spectrometry (APMS). The LCHP1 and LCHP2 are able to specifically target Leydig cells of the testis and undergo cell internalization as well as target the testis at the in vivo level, hence providing an opportunity to be utilized as a potential ligand for drug delivery to the testis.

DCC
Also flagged:Dextrinconjugationcolistinacute kidney injuryGram-negative infectionsamylase
Journal Article 2024-02-05 ✓ 1 Snippet Varache M, Rizzo S, Sayers EJ, Newbury L, Mason A, Liao CT, Chiron E, Bourdiec N, Jones A, Fraser DJ, Taylor PR, Jones AT, Thomas DW, Ferguson EL.
In-Text Gene Mentions

BCA protein assay kit, N,N′-dicyclohexyl carbodiimide (DCC), 1-ethyl-3-(3-(dimethylamino)propyl carbodiimide hydrochloride) (EDC), GibcoTM-branded keratinocyte serum-free medium (K-SFM) with l-glutamine, epidermal growth factor (EGF), bovine pituitary extract (BPE), Dulbecco's modified Eagle's medium (DMEM) with high glucose (4.5 g L−1) and GlutaMAXTM, fetal bovine serum (FBS), 0.05% w/v trypsin-0.53 mM EDTA, Oregon GreenTM 488 (OG) cadaverine, OG carboxylic acid, wheat germ agglutinin-Alexa 594 (WGA-AF594), leupeptin, Hoechst 33342, BODIPYTM TR Ceramide complexed to bovine serum albumin (BSA), MitotrackerTM Red FM, high capacity cDNA kit and power SYBR green were obtained from ThermoFisher Scientific (Loughborough, UK).

Show Full Abstract

The acute kidney injury (AKI) and dose-limiting nephrotoxicity, which occurs in 20-60% of patients following systemic administration of colistin, represents a challenge in the effective treatment of multi-drug resistant Gram-negative infections. To reduce clinical toxicity of colistin and improve targeting to infected/inflamed tissues, we previously developed dextrin-colistin conjugates, whereby colistin is designed to be released by amylase-triggered degradation of dextrin in infected and inflamed tissues, after passive targeting by the enhanced permeability and retention effect. Whilst it was evident <i>in vitro</i> that polymer conjugation can reduce toxicity and prolong plasma half-life, without significant reduction in antimicrobial activity of colistin, it was unclear how dextrin conjugation would alter cellular uptake and localisation of colistin in renal tubular cells <i>in vivo</i>. We discovered that dextrin conjugation effectively reduced colistin's toxicity towards human kidney proximal tubular epithelial cells (HK-2) <i>in vitro</i>, which was mirrored by significantly less cellular uptake of Oregon Green (OG)-labelled dextrin-colistin conjugate, when compared to colistin. Using live-cell confocal imaging, we revealed localisation of both, free and dextrin-bound colistin in endolysosome compartments of HK-2 and NRK-52E cells. Using a murine AKI model, we demonstrated dextrin-colistin conjugation dramatically diminishes both proximal tubular injury and renal accumulation of colistin. These findings reveal new insight into the mechanism by which dextrin conjugation can overcome colistin's renal toxicity and show the potential of polymer conjugation to improve the side effect profile of nephrotoxic drugs.

HFE
Also flagged:type I diabetes mellitusglycogenGHtype 1 DMAspartate transaminaseAST
Journal Article 2024-02-05 ✓ 1 Snippet Jarasvaraparn C, González IA, Tolliver KM, Haddad NG, Molleston JP.
In-Text Gene Mentions

…metabolic liver disease,hemochromatosis, and so forth.…

Show Full Abstract

<h4>Introduction</h4>Glycogenic hepatopathy (GH) is a rare complication of type I diabetes mellitus (DM1), resulting in abnormal deposition of glycogen in the liver due to poor glycemic control. Clinical characteristics and natural history of GH are not completely understood in children. In this study, we investigated clinical, biochemical, histologic parameters and outcomes in children with GH.<h4>Method</h4>This was a retrospective review of patients less than 18 years old diagnosed with GH and DM. GH was confirmed on liver biopsy. Medical records were reviewed for clinical presentation, laboratory tests, and clinical outcomes. Liver biopsy findings were reviewed by a pediatric pathologist (I. A. G.).<h4>Results</h4>Nine children were diagnosed with GH and type 1 DM. The median age at diagnosis of GH was 16 (IQR 14.5-17) years. Duration of diagnosis of DM until GH diagnosis was 7 (IQR 5-11) years. The median frequency of diabetic ketoacidosis before GH diagnosis was three times (IQR 2-5.25). Peak Aspartate transaminase (AST) and Alanine transaminase (ALT) ranged from 115 to 797, and 83-389 units/L, respectively. Only two children had mild fibrosis. Seven of nine had steatosis without steatohepatitis. There was no correlation between glycosylated hemoglobin (HbA1c), or other laboratory tests and liver fibrosis on biopsy. HbA1c was 11.2 (IQR 10.2-12.8) at GH diagnosis and 9.8 (IQR 9.5-10.8) with normalization of liver enzymes.<h4>Conclusion</h4>GH appears to be related to poor glycemic control in teenagers with long-term diabetes. GH presents with high to very high aminotransferase especially AST > ALT and resolves with modestly improved glycemic control. Diffuse hepatocyte swelling, steatosis, minimal fibrosis without hepatocyte ballooning or lobular inflammation are most common histological features.

bioRxiv 2024-02-05 Preprint (No Snippets API) Viola M, Bebelman MP, Maas RGC, Verweij FJ, Seinen CS, de Jager SCA, Vader P, Pegtel DM, Sluijter JPG.
Show Full Abstract

Extracellular vesicles (EVs) have emerged as important mediators of intercellular communication in the heart under homeostatic and pathological conditions, such as myocardial infarction (MI). However, the basic mechanisms driving cardiomyocyte-derived EV (CM-EV) production following stress are poorly understood. In this study, we generated human induced pluripotent stem cell-derived cardiomyocytes (hiPSC-CMs) that express NanoLuc-tetraspanin reporters. These modified hiPSC-CMs allow for robust quantification of CM-EV secretion from small numbers of cells without the need for time-consuming EV isolation techniques. We subjected these cells to a panel of small molecules to study their effect on CM-EV biogenesis and secretion under basal and stress-associated conditions. We observed that EV biogenesis is context-dependent in hiPSC-CMs. Nutrient starvation decreases CM-EV secretion while hypoxia increases the production of CM-EVs in a nSmase2-dependent manner. Moreover, the inflammatory cytokine TNF-α increased CM-EV secretion through a process involving NLRP3 inflammasome activation and mTOR signaling. Here, we detailed for the first time the regulatory mechanisms of EV biogenesis in hiPSC-CMs upon MI-associated stressors.

Research Square 2024-02-05 Preprint (No Snippets API) Fang Z, Wang C, Zhu J, Yang GY.
Show Full Abstract

Joint iron overload in hemochromatosis induces M1 polarization in synovial macrophages, releasing pro-inflammatory factors and leading to osteoarthritis development. However, the mechanism by which iron overload regulates M1 polarization remains unclear. This study aims to elucidate the mechanism by which synovial iron overload promotes macrophage M1 polarization. Cell morphology, Prussian blue staining, qPCR, WB, ELISA, HE staining, saffranine O-staining and immunohistochemical analysis were performed. In vitro, iron-treated macrophages exhibited Prussian Blue staining indicative of iron overload and morphological changes towards M1 polarization. qPCR and Western Blot revealed increased expression of the M1 polarization markers iNOS and its protein. ELISA showed elevated TNF-α and IL-6 levels in supernatants. In vivo, ferrozine assay indicated significantly increased serum iron concentrations in all groups except A-Ctrl; Prussian Blue staining showed increased liver iron deposition in all groups except A-Ctrl. Iron deposition in rat synovium decreased in a DFO concentration-dependent manner; immunohistochemistry showed a corresponding decrease in iNOS and phosphorylated 4E-BP1 expression, and an increase in Arg-1 expression. Intracellular iron overload may exacerbate joint cartilage damage by promoting synovial macrophage M1 polarization through phosphorylation of 4E-BP1 in the mTORC1-p70S6K/4E-BP1 pathway.

ZNF311
Also flagged:Cell cycle-dependent kinase 2CDK2CDK4cell cycle-binding
Journal Article 2024-02-04 ✓ 2 Snippets Liu Z, Yang Y, Sun X, Ma R, Zhang W, Wang W, Yang G, Wang H, Zhang J, Wang Y, Tian J.
In-Text Gene Mentions

…were used (human):ZNF311(sense, 5′-3′): GATGGAAGCCAAGG…

…5′-3′): GATGGAAGCCAAGGAAACCTGCZNF311(antisense, 5′-3′): TGCCTTTGAG…

Show Full Abstract

Cell cycle-dependent kinase 2 (CDK2) is located downstream of CDK4/6 in the cell cycle and regulates cell entry into S-phase by binding to Cyclin E and hyper-phosphorylating Rb. Proto-oncogene murine double minute 2 (MDM2) is a key negative regulator of p53, which is highly expressed in tumors and plays an important role in tumorigenesis and progression. In this study, we identified a dual inhibitor of CDK2 and MDM2, III-13, which had good selectivity for inhibiting CDK2 activity and significantly reduced MDM2 expression. In vitro results showed that III-13 inhibited proliferation of a wide range of tumor cells, regardless of whether Cyclin E1 (CCNE1) was overexpressed or not. The results of in vivo experiments showed that III-13 significantly inhibited proliferation of tumor cells and did not affect body weight of mice. The results of the druggability evaluation showed that III-13 was characterized by low bioavailability and poor membrane permeability when orally administered, suggesting the necessity of further structural modifications. Therefore, this study provided a lead compound for antitumor drugs, especially those against CCNE1-amplified tumor proliferation.

PRDX6
Also flagged:Pathogenesisamyotrophic lateral sclerosisALScalciummitochondriallipid
Journal Article 2024-02-04 ✓ 5 Snippets Yang K, Liu Y, Zhang M.
In-Text Gene Mentions

BBB: blood–brain barrier; ALS: amyotrophic lateral sclerosis; SALS: sporadic amyotrophic lateral sclerosis; FALS: familial amyotrophic lateral sclerosis; FTD: frontotemporal dementia; CNS: central nervous system; GFAP: glial fibrillary acidic protein; MNs: motor neurons; AD: Alzheimer’s disease; MS: multiple sclerosis; PD: Parkinson’s disease; LPS: lipopolysaccharide; TRAIL: TNF-related apoptosis-inducing ligand; NDs: neurodegenerative diseases; HD: Huntington’s disease; ROS: reactive oxygen species; SOD1: superoxide dismutase-1; ER: endoplasmic reticulum; SOCE: store-operated Ca2+ entry; polyP: polyphosphate; ACM: astrocyte conditioned media; iPSC: induced pluripotent stem cell; FTD: frontotemporal dementia; TARDBP: transactive response DNA-binding protein; C9ORF72: chromosome 9 open reading frame 72; CSF: cerebrospinal fluid; EAATs: excitatory amino acid transporters; GLT-1: glutamate transporter 1; ERAD: ER-associated degradation; NAD: nicotinamide adenine dinucleotide; FABPs: fatty-acid-binding proteins; PGE2: prostaglandin E2; COX2: cyclooxygenase 2; SREBP2: sterol regulatory element-binding protein-2; PRDX6: peroxiredoxin 6; MTOR: mechanistic target of rapamycin kinase; IGF1R: insulin-like growth factor 1 receptor; SIRT6: sirtuin 6; Nrf2: nuclear factor erythroid 2-related factor 2; NPCs: neural progenitor cells; GDNF: glial-cell-derived neurotrophic factor; Cx43: connexin 43; VCP: valosin-containing protein; TDP-43: TAR DNA binding protein 43; FUS: fused in sarcoma; iPSC: induced pluripotent stem cell; LPS: lipopolysaccharide; C3: complement component 3; TNFSF 10: tumor necrosis factor superfamily member 10; EAE: experimental autoimmune encephalomyelitis; PbAc: lead acetate; PARK7/DJ-1: Parkinson’s disease protein 7; MC: motor cortex; SC: spinal cortex; DCA: dichloroacetate; PDH: pyruvate dehydrogenase; WT: wild type; Glu: glutamate.

In general, the activation of inflammatory factors, upregulation of peroxiredoxin 6 (PRDX6), and gene mutation in astrocytes are the main contributors to the reactive transformation of astrocytes in ALS (Figure 1).

…peroxiredoxin 6 (PRDX6) , and gene…

…the expression ofPRDX6in the spinal…

…ory element-binding protein-2;PRDX6: peroxiredoxin 6; MTOR:…

Show Full Abstract

Astrocytes displaying reactive phenotypes are characterized by their ability to remodel morphologically, molecularly, and functionally in response to pathological stimuli. This process results in the loss of their typical astrocyte functions and the acquisition of neurotoxic or neuroprotective roles. A growing body of research indicates that these reactive astrocytes play a pivotal role in the pathogenesis of amyotrophic lateral sclerosis (ALS), involving calcium homeostasis imbalance, mitochondrial dysfunction, abnormal lipid and lactate metabolism, glutamate excitotoxicity, etc. This review summarizes the characteristics of reactive astrocytes, their role in the pathogenesis of ALS, and recent advancements in astrocyte-targeting strategies.

HFE
Also flagged:FerroptosisIrondeathchronic diseaseshepatic cancercardiovascular diseases
Journal Article 2024-02-04 ✓ 1 Snippet El Hajj S, Canabady-Rochelle L, Fries-Raeth I, Gaucher C.
In-Text Gene Mentions

…deficiency anemia andhemochromatosiscaused by iron…

Show Full Abstract

Dysregulation of iron homeostasis causes iron-mediated cell death, recently described as ferroptosis. Ferroptosis is reported in many chronic diseases, such as hepatic cancer, renal, and cardiovascular diseases (heart failure, atherosclerosis). However, there is a notable scarcity of research studies in the existing literature that explore treatments capable of preventing ferroptosis. Additionally, as far as the author is aware, there is currently no established model for studying ferroptosis within cardiovascular cells, which would be essential for assessing metal-chelating molecules with the potential ability to inhibit ferroptosis and their application in the treatment of cardiovascular diseases. In this study, a smooth muscle cell-based ferroptosis model is developed upon the inhibition of the system X<sub>c</sub><sup>-</sup> transporter by erastin associated or not with Fe(III) overload, and its rescue upon the introduction of well-known iron chelators, deferoxamine and deferiprone. We showed that erastin alone decreased the intracellular concentration of glutathione (GSH) without affecting peroxidized lipid concentrations. Erastin with ferric citrate was able to decrease intracellular GSH and induce lipid peroxidation after overnight incubation. Only deferiprone was able to rescue the cells from ferroptosis by decreasing lipid peroxidation via iron ion chelation in a 3:1 molar ratio.

DCC
Also flagged:flavonoidskurarinonekushenols Asophoraflavanone Ghydroxylcell proliferation
Journal Article 2024-02-04 ✓ 1 Snippet Nishi K, Imamura I, Hoashi K, Kiyama R, Mitsuiki S.
In-Text Gene Mentions

…/ v )DCC-FBS.…

Show Full Abstract

<i>Sophora flavescens</i> is a medicinal herb distributed widely in Japan and it has been used to treat various diseases and symptoms. To explore its pharmacological use, we examined the estrogenic activity of four prenylated flavonoids, namely kurarinone, kushenols A and I, and sophoraflavanone G, which are characterized by the lavandulyl group at position 8 of ring A, but have variations in the hydroxyl group at positions 3 (ring C), 5 (ring A) and 4' (ring B). These prenylated flavonoids were examined via cell proliferation assays using sulforhodamine B, Western blotting, and RT-PCR, corresponding to cell, protein, and transcription assays, respectively, based on estrogen action mechanisms. All the assays employed here found weak but clear estrogenic activities for the prenylated flavonoids examined. Furthermore, the activities were inhibited by an estrogen receptor antagonist, suggesting that the activities were likely being mediated by the estrogen receptors. However, there were differences in the activity, attributable to the hydroxyl group at position 4', which is absent in kushenol A. While the estrogenic activity of kurarinone and sophoraflavanone G has been reported before, to the best of our knowledge, there are no such reports on kushenols A and I. Therefore, this study represents the first report of their estrogenic activity.

HFE
Also flagged:IronSMADHepcidinbone morphogenic proteinBMPBMP6
Journal Article 2024-02-04 ✓ 1 Snippet Zhang N, Yang P, Li Y, Ouyang Q, Hou F, Zhu G, Zhang B, Huang J, Jia J, Xu A.
In-Text Gene Mentions

…diseases such ashemochromatosis.…

Show Full Abstract

<h4>Background and aims</h4>Liver iron overload can induce hepatic expression of bone morphogenic protein (BMP) 6 and activate the BMP/SMAD pathway. However, serum iron overload can also activate SMAD but does not induce BMP6 expression. Therefore, the mechanisms through which serum iron overload activates the BMP/SMAD pathway remain unclear. This study aimed to clarify the role of SMURF1 in serum iron overload and the BMP/SMAD pathway.<h4>Methods</h4>A cell model of serum iron overload was established by treating hepatocytes with 2 mg/mL of holo-transferrin (Holo-Tf). A serum iron overload mouse model and a liver iron overload mouse model were established by intraperitoneally injecting 10 mg of Holo-Tf into C57BL/6 mice and administering a high-iron diet for 1 week followed by a low-iron diet for 2 days. Western blotting and real-time PCR were performed to evaluate the activation of the BMP/SMAD pathway and the expression of hepcidin.<h4>Results</h4>Holo-Tf augmented the sensitivity and responsiveness of hepatocytes to BMP6. The E3 ubiquitin-protein ligase SMURF1 mediated Holo-Tf-induced SMAD1/5 activation and hepcidin expression; specifically, SMURF1 expression dramatically decreased when the serum iron concentration was increased. Additionally, the expression of SMURF1 substrates, which are important molecules involved in the transduction of BMP/SMAD signaling, was significantly upregulated. Furthermore, <i>in vivo</i> analyses confirmed that SMURF1 specifically regulated the BMP/SMAD pathway during serum iron overload.<h4>Conclusions</h4>SMURF1 can specifically regulate the BMP/SMAD pathway by augmenting the responsiveness of hepatocytes to BMPs during serum iron overload.

Also flagged:SOX30tumorlung cancercancercancersSRY‐box transcription factor 30
Journal Article 2024-02-04 No Snippets Sun N, Wang C, Gao P, Wang R, Zhang Y, Qi X.
Show Full Abstract

SRY-box transcription factor 30 (SOX30) participates in tumor cell apoptosis in lung cancer. The occurrence of somatic SOX30 mutations, the expression signature of SOX30 in normal and cancer tissues, the correlation of SOX30 with immune cells and immune-related genes, and the clinical significance of SOX30 in various cancers have stimulated interest in SOX30 as a potential cancer biomarker. SOX30 influences drug sensitivity and tumor immunity in specific cancer types. In this review, we have comprehensively summarized the latest research on the role of SOX30 in cancer by combining bioinformatics evidence and a literature review. We summarize recent research on SOX30 in cancer regarding somatic mutations, trials, transcriptome analysis, clinical information, and SOX30-mediated regulation of malignant phenotypes. Additionally, we report on the diagnostic value of SOX30 mRNA expression levels across different cancer types. This review on the role of SOX30 in cancer progression may provide insights into possible research directions for SOX30 in cancer and a theoretical basis for guiding future studies.

Also flagged:metabolismmitochondrialfatty acidamino acidglucoselipid
Journal Article 2024-02-03 No Snippets Thalheim T, Schneider MR.
Show Full Abstract

<h4>Background</h4>Single-cell RNA sequencing (scRNA-seq) has been widely applied to dissect cellular heterogeneity in normal and diseased skin. Sebaceous glands, essential skin components with established functions in maintaining skin integrity and emerging roles in systemic energy metabolism, have been largely neglected in scRNA-seq studies.<h4>Methods</h4>Departing from mouse and human skin scRNA-seq datasets, we identified gene sets expressed especially in sebaceous glands with the open-source R-package oposSOM.<h4>Results</h4>The identified gene sets included sebaceous gland-typical genes as Scd3, Mgst1, Cidea, Awat2 and KRT7. Surprisingly, however, there was not a single overlap among the 100 highest, exclusively in sebaceous glands expressed transcripts in mouse and human samples. Notably, both species share a common core of only 25 transcripts, including mitochondrial and peroxisomal genes involved in fatty acid, amino acid, and glucose processing, thus highlighting the intense metabolic rate of this gland.<h4>Conclusions</h4>This study highlights intrinsic differences in sebaceous lipid synthesis between mice and humans, and indicates an important role for peroxisomal processes in this context. Our data also provides attractive starting points for experimentally addressing novel candidates regulating sebaceous gland homeostasis.

DARS2
Also flagged:Asparaginyl-tRNA synthetase 2Asn-RSNARS2aminoacyl-tRNA synthetasesbiosynthesisasparagine
Journal Article 2024-02-03 ✓ 2 Snippets Yang N, Chen L, Zhang Y, Wu X, Hao Y, Yang F, Yang Z, Liang J.
In-Text Gene Mentions

These clinical features were commonly in diseases with aaRSs gene mutations, including leukoencephalopathy with thalamus and brainstem involvement and high lactate (LTBL) cases with NARS2 variations, leukoencephalopathy with brainstem and spinal cord involvement, lactate elevation (LBSL) with Aspartyl-tRNA Synthetase 2 (DARS2) variations, and Alanyl-tRNA Synthetase 2 (AARS2)-related leukoencephalopathy [29].

…Aspartyl-tRNA Synthetase 2 (DARS2) variations, and Alanyl-tRNA…

Show Full Abstract

<h4>Background</h4>NARS2 as a member of aminoacyl-tRNA synthetases was necessary to covalently join a specific tRNA to its cognate amino acid. Biallelic variants in NARS2 were reported with disorders such as Leigh syndrome, deafness, epilepsy, and severe myopathy.<h4>Case presentation</h4>Detailed clinical phenotypes were collected and the NARS2 variants were discovered by whole exome sequencing and verified by Sanger sequencing. Additionally, 3D protein structure visualization was performed by UCSF Chimera. The proband in our study had early-onset status epilepticus with abnormal EEG and MRI results. She also performed global developmental delay (GDD) and myocardial dysfunction. Next-generation sequencing (NGS) and Sanger sequencing revealed compound heterozygous missense variants [NM_024678.6:exon14: c.1352G > A(p.Arg451His); c.707T > C(p.Phe236Ser)] of the NARS2 gene. The proband develops refractory epilepsy with GDD and hyperlactatemia. Unfortunately, she finally died for status seizures two months later.<h4>Conclusion</h4>We discovered two novel missense variants of NARS2 in a patient with early-onset status epilepticus and myocardial dysfunction. The NGS enables the patient to be clearly diagnosed as combined oxidative phosphorylation deficiency 24 (COXPD24, OMIM:616,239), and our findings expands the spectrum of gene variants in COXPD24.

Also flagged:autophagyagingNrf2mitochondriallung cancerCas9
Journal Article 2024-02-03 No Snippets Mayer MP, Blair L, Blatch GL, Borges TJ, Chadli A, Chiosis G, de Thonel A, Dinkova-Kostova A, Ecroyd H, Edkins AL, Eguchi T, Fleshner M, Foley KP, Fragkostefanakis S, Gestwicki J, Goloubinoff P, Heritz JA, Heske CM, Hibshman JD, Joutsen J, Li W, Lynes M, Mendillo ML, Mivechi N, Mokoena F, Okusha Y, Prahlad V, Repasky E, Sannino S, Scalia F, Shalgi R, Sistonen L, Sontag E, van Oosten-Hawle P, Vihervaara A, Wickramaratne A, Wang SXY, Zininga T.
Show Full Abstract

Preserving and regulating cellular homeostasis in the light of changing environmental conditions or developmental processes is of pivotal importance for single cellular and multicellular organisms alike. To counteract an imbalance in cellular homeostasis transcriptional programs evolved, called the heat shock response, unfolded protein response, and integrated stress response, that act cell-autonomously in most cells but in multicellular organisms are subjected to cell-nonautonomous regulation. These transcriptional programs downregulate the expression of most genes but increase the expression of heat shock genes, including genes encoding molecular chaperones and proteases, proteins involved in the repair of stress-induced damage to macromolecules and cellular structures. Sixty-one years after the discovery of the heat shock response by Ferruccio Ritossa, many aspects of stress biology are still enigmatic. Recent progress in the understanding of stress responses and molecular chaperones was reported at the 12th International Symposium on Heat Shock Proteins in Biology, Medicine and the Environment in the Old Town Alexandria, VA, USA from 28th to 31st of October 2023.

Also flagged:mitochondrialmitochondriaTraumatic brain injuryoxygencalciumbrain injury
Journal Article 2024-02-03 No Snippets Hubbard WB, Velmurugan GV, Sullivan PG.
Show Full Abstract

Mitostasis, the maintenance of healthy mitochondria, plays a critical role in brain health. The brain's high energy demands and reliance on mitochondria for energy production make mitostasis vital for neuronal function. Traumatic brain injury (TBI) disrupts mitochondrial homeostasis, leading to secondary cellular damage, neuronal degeneration, and cognitive deficits. Mild mitochondrial uncoupling, which dissociates ATP production from oxygen consumption, offers a promising avenue for TBI treatment. Accumulating evidence, from endogenous and exogenous mitochondrial uncoupling, suggests that mitostasis is closely regulating by mitochondrial uncoupling and cellular injury environments may be more sensitive to uncoupling. Mitochondrial uncoupling can mitigate calcium overload, reduce oxidative stress, and induce mitochondrial proteostasis and mitophagy, a process that eliminates damaged mitochondria. The interplay between mitochondrial uncoupling and mitostasis is ripe for further investigation in the context of TBI. These multi-faceted mechanisms of action for mitochondrial uncoupling hold promise for TBI therapy, with the potential to restore mitochondrial health, improve neurological outcomes, and prevent long-term TBI-related pathology.

Also flagged:attention-deficit/hyperactivity disorderattention-deficit hyperactivity disordersubstance use disorderADHDalcohol use disorderalcohol dependence
Journal Article 2024-02-03 No Snippets Koller D, Mitjans M, Kouakou M, Friligkou E, Cabrera-Mendoza B, Deak JD, Llonga N, Pathak GA, Stiltner B, Løkhammer S, Levey DF, Zhou H, Hatoum AS, Kember RL, Kranzler HR, Stein MB, Corominas R, Demontis D, Artigas MS, Ramos-Quiroga JA, Gelernter J, Ribasés M, Cormand B, Polimanti R.
Show Full Abstract

We characterized the genetic architecture of the attention-deficit hyperactivity disorder-substance use disorder (ADHD-SUD) relationship by investigating genetic correlation, causality, pleiotropy, and common polygenic risk. Summary statistics from genome-wide association studies (GWAS) were used to investigate ADHD (N<sub>eff</sub> = 51,568), cannabis use disorder (CanUD, N<sub>eff</sub> = 161,053), opioid use disorder (OUD, N<sub>eff</sub> = 57,120), problematic alcohol use (PAU, N<sub>eff</sub> = 502,272), and problematic tobacco use (PTU, N<sub>eff</sub> = 97,836). ADHD, CanUD, and OUD GWAS meta-analyses included cohorts with case definitions based on different diagnostic criteria. PAU GWAS combined information related to alcohol use disorder, alcohol dependence, and the items related to alcohol problematic consequences assessed by the alcohol use disorders identification test. PTU GWAS was generated a multi-trait analysis including information regarding Fagerström Test for Nicotine Dependence and cigarettes per day. Linkage disequilibrium score regression analyses indicated positive genetic correlation with CanUD, OUD, PAU, and PTU. Genomic structural equation modeling showed that these genetic correlations were related to two latent factors: one including ADHD, CanUD, and PTU and the other with OUD and PAU. The evidence of a causal effect of PAU and PTU on ADHD was stronger than the reverse in the two-sample Mendelian randomization analysis. Conversely, similar strength of evidence was found between ADHD and CanUD. CADM2 rs62250713 was a pleiotropic SNP between ADHD and all SUDs. We found seven, one, and twenty-eight pleiotropic variants between ADHD and CanUD, PAU, and PTU, respectively. Finally, OUD, CanUD, and PAU PRS were associated with increased odds of ADHD. Our findings demonstrated the contribution of multiple pleiotropic mechanisms to the comorbidity between ADHD and SUDs.

Also flagged:Cadmiumtransportersmetalsironzinccancer
Journal Article 2024-02-03 No Snippets Cirovic A, Satarug S.
Show Full Abstract

Cadmium (Cd) is an environmental toxicant of worldwide public health significance. Diet is the main non-workplace Cd exposure source other than passive and active smoking. The intestinal absorption of Cd involves transporters for essential metals, notably iron and zinc. These transporters determine the Cd body burden because only a minuscule amount of Cd can be excreted each day. The International Agency for Research on Cancer listed Cd as a human lung carcinogen, but the current evidence suggests that the effects of Cd on cancer risk extend beyond the lung. A two-year bioassay demonstrated that Cd caused neoplasms in multiple tissues of mice. Also, several non-tumorigenic human cells transformed to malignant cells when they were exposed to a sublethal dose of Cd for a prolonged time. Cd does not directly damage DNA, but it influences gene expression through interactions with essential metals and various proteins. The present review highlights the epidemiological studies that connect an enhanced risk of various neoplastic diseases to chronic exposure to environmental Cd. Special emphasis is given to the impact of body iron stores on the absorption of Cd, and its implications for breast cancer prevention in highly susceptible groups of women. Resistance to cell death and other cancer phenotypes acquired during Cd-induced cancer cell transformation, under in vitro conditions, are briefly discussed. The potential role for the ZnT1 efflux transporter in the cellular acquisition of tolerance to Cd cytotoxicity is highlighted.

PRDX6
Also flagged:ferroptosisdeathautophagyironmetabolismpathogenesis
Journal Article 2024-02-03 ✓ 1 Snippet Cui M, Chen F, Shao L, Wei C, Zhang W, Sun W, Wang J.
In-Text Gene Mentions

…acute myocardial injuryPRDX6Peroxido-reducing protein 6…

Show Full Abstract

<h4>Objective</h4>This review discusses recent experimental and clinical findings related to ferroptosis, with a focus on the role of MSCs. Therapeutic efficacy and current applications of MSC-based ferroptosis therapies are also discussed.<h4>Background</h4>Ferroptosis is a type of programmed cell death that differs from apoptosis, necrosis, and autophagy; it involves iron metabolism and is related to the pathogenesis of many diseases, such as Parkinson's disease, cancers, and liver diseases. In recent years, the use of mesenchymal stem cells (MSCs) and MSC-derived exosomes has become a trend in cell-free therapies. MSCs are a heterogeneous cell population isolated from a diverse range of human tissues that exhibit immunomodulatory functions, regulate cell growth, and repair damaged tissues. In addition, accumulating evidence indicates that MSC-derived exosomes play an important role, mainly by carrying a variety of bioactive substances that affect recipient cells. The potential mechanism by which MSC-derived exosomes mediate the effects of MSCs on ferroptosis has been previously demonstrated. This review provides the first overview of the current knowledge on ferroptosis, MSCs, and MSC-derived exosomes and highlights the potential application of MSCs exosomes in the treatment of ferroptotic conditions. It summarizes their mechanisms of action and techniques for enhancing MSC functionality. Results obtained from a large number of experimental studies revealed that both local and systemic administration of MSCs effectively suppressed ferroptosis in injured hepatocytes, neurons, cardiomyocytes, and nucleus pulposus cells and promoted the survival and regeneration of injured organs.<h4>Methods</h4>We reviewed the role of ferroptosis in related tissues and organs, focusing on its characteristics in different diseases. Additionally, the effects of MSCs and MSC-derived exosomes on ferroptosis-related pathways in various organs were reviewed, and the mechanism of action was elucidated. MSCs were shown to improve the disease course by regulating ferroptosis.

Also flagged:Post-stroke depressionmood disorderstrokenuclear factor κBNF-κBbrain-derived neurotrophic factor
Journal Article 2024-02-03 No Snippets Feng X, Ma X, Li J, Zhou Q, Liu Y, Song J, Liu J, Situ Q, Wang L, Zhang J, Lin F.
Show Full Abstract

Post-stroke depression (PSD) is a complex mood disorder that emerges in individuals following a stroke, characterized by the development of depressive symptoms. The pathogensis of PSD is diverse, with inflammation playing a vital role in its onset and progression. Emerging evidence suggests that microglial activation, astrocyte responses, nuclear factor κB(NF-κB) signaling, dysregulation of the hypothalamic pituitary adrenal (HPA) axis, alterations in brain-derived neurotrophic factor (BDNF) expression, neurotransmitter imbalances, adenosine triphosphate (ATP) and its receptors and oxidative stress are intricately linked to the pathogenesis of PSD. The involvement of inflammatory cytokines in these processes highlights the significance of the inflammatory pathway. Integrating these hypotheses, the inflammatory mechanism offers a novel perspective to expand therapeutic strategies for PSD.

medRxiv 2024-02-03 Preprint (No Snippets API) Goodman MO, Faquih T, Paz V, Nagarajan P, Lane JM, Spitzer B, Maher M, Chung J, Cade BE, Purcell SM, Zhu X, Noordam R, Phillips AJK, Kyle SD, Spiegelhalder K, Weedon MN, Lawlor DA, Rotter JI, Taylor KD, Isasi CR, Sofer T, Dashti HS, Rutter MK, Redline S, Saxena R, Wang H.
Show Full Abstract

<h4>ABSTRACT</h4> Recent genome-wide association studies (GWASs) of several individual sleep traits have identified hundreds of genetic loci, suggesting diverse mechanisms. Moreover, sleep traits are moderately correlated, and together may provide a more complete picture of sleep health, while also illuminating distinct domains. Here we construct novel sleep health scores (SHSs) incorporating five core self-report measures: sleep duration, insomnia symptoms, chronotype, snoring, and daytime sleepiness, using additive (SHS-ADD) and five principal components-based (SHS-PCs) approaches. GWASs of these six SHSs identify 28 significant novel loci adjusting for multiple testing on six traits (p<8.3e-9), along with 341 previously reported loci (p<5e-08). The heritability of the first three SHS-PCs equals or exceeds that of SHS-ADD (SNP-h 2 =0.094), while revealing sleep-domain-specific genetic discoveries. Significant loci enrich in multiple brain tissues and in metabolic and neuronal pathways. Post GWAS analyses uncover novel genetic mechanisms underlying sleep health and reveal connections to behavioral, psychological, and cardiometabolic traits.

HTT
Also flagged:response to injuryinfectionneurodegenerative diseasespathogenesistausynaptogenesis
Journal Article 2024-02-02 ✓ 1 Snippet Edison P.
In-Text Gene Mentions

…of mutant huntingtin (Htt) aggregates but did…

Show Full Abstract

Astrocytes are abundantly and ubiquitously expressed cell types with diverse functions throughout the central nervous system. Astrocytes show remarkable plasticity and exhibit morphological, molecular, and functional remodeling in response to injury, disease, or infection of the central nervous system, as evident in neurodegenerative diseases. Astroglial mediated inflammation plays a prominent role in the pathogenesis of neurodegenerative diseases. This review focus on the role of astrocytes as essential players in neuroinflammation and discuss their morphological and functional heterogeneity in the normal central nervous system and explore the spatial and temporal variations in astroglial phenotypes observed under different disease conditions. This review discusses the intimate relationship of astrocytes to pathological hallmarks of neurodegenerative diseases. Finally, this review considers the putative therapeutic strategies that can be deployed to modulate the astroglial functions in neurodegenerative diseases. HIGHLIGHTS: Astroglia mediated neuroinflammation plays a key role in the pathogenesis of neurodegenerative diseases. Activated astrocytes exhibit diverse phenotypes in a region-specific manner in brain and interact with β-amyloid, tau, and α-synuclein species as well as with microglia and neuronal circuits. Activated astrocytes are likely to influence the trajectory of disease progression of neurodegenerative diseases, as determined by the stage of disease, individual susceptibility, and state of astroglial priming. Modulation of astroglial activation may be a therapeutic strategy at various stages in the trajectory of neurodegenerative diseases to modify the disease course.

TNFSF4
Also flagged:CCL11breast cancertumorinvasive breast cancerBRCAAkt
Journal Article 2024-02-02 ✓ 1 Snippet Chen X, Meng C, Wang X, Wu Z, Sun X, Sun C, Zheng L, Li W, Jia W, Tang T.
In-Text Gene Mentions

…such as CD40LG,TNFSF4, and CD48 (…

Show Full Abstract

<h4>Background</h4>CCL11, a chemokine known for recruiting immune cells to the tumor microenvironment (TME), has an unclear role in the context of its expression, patient prognosis, and the presence of tumor-infiltrating immune cells (TILs) in breast cancer.<h4>Methods</h4>The expression of CCL11 in invasive breast cancer (BRCA) was analyzed using TCGA database. Survival curve and Cox regression analysis determined the potential of CCL11 as an independent prognostic indicator. GSEA performed functional analysis on genes related to CCL11. CIBERSORT algorithm quantified the infiltration level of immune cells with varying CCL11 expression. Lastly, the correlation between CCL11 expression and anticancer drug sensitivity was examined. Immunohistochemistry (IHC) and qRT-PCR confirmed CCL11 expression in clinical tissue samples. The anti-tumor efficacy of CCL11 was investigated using CCK-8, plate formation, transwell assay, and Western blot.<h4>Results</h4>CCL11 expression was elevated in BRCA tumor tissues compared to adjacent normal tissues. Recurrence-free survival (RFS) was longer in patients with high expression of CCL11. Enrichment and co-expression analyses revealed CCL11's association with numerous immune-related signaling pathways and genes. Validation studies confirmed high CCL11 expression in breast cancer tissues. In vitro experiments substantiated CCL11's anticancer effects in BRCA.<h4>Conclusion</h4>CCL11 expression correlates with immune cell infiltration in breast cancer, indicating its potential as a prognostic biomarker for BRCA.

DCC
Also flagged:glioblastoma multiformeGBMbrain tumorstumors of thegliosarcomaGS
Journal Article 2024-02-02 ✓ 2 Snippets Zechel C, Loy M, Wegner C, Dahlke E, Soetje B, Baehr L, Leppert J, Ostermaier JJ, Lueg T, Nielsen J, Elßner J, Willeke V, Marzahl S, Tronnier V, Madany Mamlouk A.
In-Text Gene Mentions

The proteins DARPP32 [56] and the Dopa-Decarboxylase AADC/DCC [57], which are expressed in dopaminergic neurons but also in certain cancer cells [71–73] displayed high expression levels in two of the GS- and three of the GBM-derived cell lines.

…d the Dopa-Decarboxylase AADC/DCC[ 57 ],…

Show Full Abstract

Glioblastoma multiforme (GBM) and the GBM variant gliosarcoma (GS) are among the tumors with the highest morbidity and mortality, providing only palliation. Stem-like glioma cells (SLGCs) are involved in tumor initiation, progression, therapy resistance, and relapse. The identification of general features of SLGCs could contribute to the development of more efficient therapies. Commercially available protein arrays were used to determine the cell surface signature of eight SLGC lines from GBMs, one SLGC line obtained from a xenotransplanted GBM-derived SLGC line, and three SLGC lines from GSs. By means of non-negative matrix factorization expression metaprofiles were calculated. Using the cophenetic correlation coefficient (CCC) five metaprofiles (MPs) were identified, which are characterized by specific combinations of 7-12 factors. Furthermore, the expression of several factors, that are associated with GBM prognosis, GBM subtypes, SLGC differentiation stages, or neural identity was evaluated. The investigation encompassed 24 distinct SLGC lines, four of which were derived from xenotransplanted SLGCs, and included the SLGC lines characterized by the metaprofiles. It turned out that all SLGC lines expressed the epidermal growth factor EGFR and EGFR ligands, often in the presence of additional receptor tyrosine kinases. Moreover, all SLGC lines displayed a neural signature and the IDH1 wildtype, but differed in their p53 and PTEN status. Pearson Correlation analysis identified a positive association between the pluripotency factor Sox2 and the expression of FABP7, Musashi, CD133, GFAP, but not with MGMT or Hif1α. Spherical growth, however, was positively correlated with high levels of Hif1α, CDK4, PTEN, and PDGFRβ, whereas correlations with stemness factors or MGMT (MGMT expression and promoter methylation) were low or missing. Factors highly expressed by all SLGC lines, irrespective of their degree of stemness and growth behavior, are Cathepsin-D, CD99, EMMPRIN/CD147, Intβ1, the Galectins 3 and 3b, and N-Cadherin.

HTT
Also flagged:neurogenetic disordersdisordersmyotonic dystrophy type 1ATXN1dentatorubral-pallidoluysian atrophyspinocerebellar ataxia type 7
Journal Article 2024-02-02 ✓ 2 Snippets Yoon JG, Lee S, Cho J, Kim N, Kim S, Kim MJ, Kim SY, Moon J, Chae JH.
In-Text Gene Mentions

…, ATXN7 ,HTT, NOP56 ,…

…, AR andHTT).…

Show Full Abstract

To date, approximately 50 short tandem repeat (STR) disorders have been identified; yet, clinical laboratories rarely conduct STR analysis on exomes. To assess its diagnostic value, we analyzed STRs in 6099 exomes from 2510 families with mostly suspected neurogenetic disorders. We employed ExpansionHunter and REViewer to detect pathogenic repeat expansions, confirming them using orthogonal methods. Genotype-phenotype correlations led to the diagnosis of thirteen individuals in seven previously undiagnosed families, identifying three autosomal dominant disorders: dentatorubral-pallidoluysian atrophy (n = 3), spinocerebellar ataxia type 7 (n = 2), and myotonic dystrophy type 1 (n = 2), resulting in a diagnostic gain of 0.28% (7/2510). Additionally, we found expanded ATXN1 alleles (≥39 repeats) with varying patterns of CAT interruptions in twelve individuals, accounting for approximately 0.19% in the Korean population. Our study underscores the importance of integrating STR analysis into exome sequencing pipeline, broadening the application of exome sequencing for STR assessments.

NEGR1
Also flagged:TAS2R385-HT2A receptorCD36taste receptorsglucosesalt
Journal Article 2024-02-02 ✓ 3 Snippets Hejazi J, Amiri R, Nozarian S, Tavasolian R, Rahimlou M.
In-Text Gene Mentions

…SH2B1, KCTD15, MTCH2,NEGR1, and BDNF and…

…to KCTD15 andNEGR1, a reduction in…

…risk allele forNEGR1also had reduced…

Show Full Abstract

<h4>Background</h4>Over the last decade, the results of several studies have indicated that adults' food preferences, consumption, and dietary choices vary depending on their genotype characteristics. However, the results of studies related to genes and polymorphisms involved in this phenomenon are contradictory. This study is a systematic review designed to evaluate the genetic determinants of food preferences.<h4>Methods</h4>This study was conducted following the guidelines of the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA). Searches were conducted to identify articles testing the impact of genotypes on food choices, preferences, and intake in healthy adults. The search included all relevant keywords, and studies published between 1/1/1994 and October 2022 were considered. We assessed the quality of included studies and evaluated the risk of bias using the Newcastle-Ottawa Scale (NOS) for observational studies.<h4>Results</h4>A total of 8,510 records were identified through our search method, and finally, 50 studies were included in this study. The majority of the studies evaluated the association of genetic variants with preferences for macronutrients, sweet, bitter, and fatty foods. The results of our study suggest a significant correlation between TAS2R38 variants (rs713598, rs1726866, rs10246939) and bitter and sweet taste preferences. Additionally, we found a considerable association between the T102C polymorphism of the 5-HT2A receptor gene and a higher intake of protein, and rs1761667 (CD36) was associated with fat preference.<h4>Conclusion</h4>In conclusion, this study revealed a significant association between certain genetic variants and food preferences among adults.

CCPG1
Also flagged:endometrial cancerapical hyperplasiaendometrial hyperplasiaglucosemetabolismlipid
Journal Article 2024-02-02 ✓ 1 Snippet Li X, Wang Y, Wang J, Fan Y, Wang J.
In-Text Gene Mentions

…FOXO1, RNF4, EXOC6B,CCPG1, RREB1, and ZBTB38)…

Show Full Abstract

<h4>Background</h4>Fertility preservation treatment is increasingly essential for patients with apical endometrial hyperplasia (AEH) and early endometrial cancer (EEC) worldwide. Complete regression (CR) is the main endpoint of this treatment. Accurately predicting CR and implementing appropriate interventions during treatment are crucial for these patients.<h4>Methods</h4>We conducted a retrospective study involving 193 patients diagnosed with atypical AEH or EEC, enrolled from January 2012 to March 2022 at our center. We evaluated 24 clinical parameters as candidate predictors and employed LASSO regression to develop a prediction model for CR. Subsequently, a nomogram was constructed to predict CR after the treatment. We evaluated the performance of the nomogram using receiver operator characteristic (ROC) curve and decision curve analysis (DCA) to assess its predictive accuracy. Additionally, we employed cumulative curves to determine the CR rate among patients.<h4>Results</h4>Out of the 193 patients, 173 achieved CR after undergoing fertility preservation treatment. We categorized features with similar properties and provided a list of formulas based on their coefficients. The final model, named GLOBAL (including basic information, characteristics, blood pressure, glucose metabolism, lipid metabolism, immunohistochemistry, histological type, and medication), comprised eight variables identified using LASSO regression. A nomogram incorporating these eight risk factors was developed to predict CR. The GLOBAL model exhibited an AUC of 0.907 (95% CI 0.828-0.969). Calibration plots demonstrated a favorable agreement between the predicted probability by the GLOBAL model and actual observations in the cohort. The cumulative curve analysis revealed varying cumulative CR rates among patients in the eight subgroups. Categorized analysis demonstrated significant diversity in the effects of the GLOBAL model on CR among patients with different total points (p < 0.05).<h4>Conclusion</h4>We have developed and validated a model that significantly enhances the predictive accuracy of CR in AEH and EEC patients seeking fertility preservation treatment.

HFE
Also flagged:bevacizumabage-related macular degenerationneovascular age related macular degenerationziv-afliberceptvascular endothelial growth factorVEGF
Journal Article 2024-02-02 ✓ 1 Snippet Kanadani T, Rabelo N, Takahashi D, Magalhães L, Farah M.
In-Text Gene Mentions

…and 2), aneurysmaltype 1 neovascularization1 neovascularization (PCV)…

Show Full Abstract

<h4>Purpose</h4>To evaluate the structural and functional changes in eyes with neovascular age related macular degeneration (nAMD) in a real-world setting, using Treat and Extend protocol (T&E), comparing four antiangiogenic agents.<h4>Methods</h4>Prospective, observational, case series study performed in 131 patients with the exudative form of nAMD. Patients were randomly assigned into four groups according to the antiangiogenic agent. During the first year, all eyes received at least 3 monthly intravitreal injections of antiangiogenic agents, and afterwards, were submitted to the T&E.<h4>Results</h4>There was statistically significant difference (p < 0.05) between pre- and post-treatment in the best corrected visual acuity measurements by drug used. Patients who used aflibercept had significantly fewer injections than patients using the other drugs (mean = 9.03). No significant difference was observed between the drugs bevacizumab, ranibizumab and ziv-aflibercept. With regard to biomarkers, patients who used aflibercept and had lower baseline central retinal thickness, absence of hyperreflective foci and no subretinal hyperreflective material had the lowest number of injections.<h4>Conclusion</h4>Results indicate that over 2 years, Intravitreal aflibercept on T&E provided better visual and anatomical improvements when compared to other drugs used in this study with significantly fewer injections.

HFE
Also flagged:nonalcoholic fatty liver diseaseNAFLDnonalcoholic steatohepatitisNASHcirrhosisliver fibrosis
Journal Article 2024-02-02 ✓ 1 Snippet Miyake T, Furukawa S, Matsuura B, Yoshida O, Miyazaki M, Shiomi A, Kanamoto A, Nakaguchi H, Nakamura Y, Imai Y, Koizumi M, Watanabe T, Yamamoto Y, Koizumi Y, Tokumoto Y, Hirooka M, Kumagi T, Takesita E, Ikeda Y, Abe M, Hiasa Y.
In-Text Gene Mentions

…rimary sclerosing cholangitis,hemochromatosis, and Wilson’s disease;…

Show Full Abstract

<h4>Backgruound</h4>Poor lifestyle habits may worsen nonalcoholic fatty liver disease (NAFLD), with progression to nonalcoholic steatohepatitis (NASH) and cirrhosis. This study investigated the association between glycemic control status and hepatic histological findings to elucidate the effect of glycemic control on NAFLD.<h4>Methods</h4>This observational study included 331 patients diagnosed with NAFLD by liver biopsy. Effects of the glycemic control status on histological findings of NAFLD were evaluated by comparing the following four glycemic status groups defined by the glycosylated hemoglobin (HbA1c) level at the time of NAFLD diagnosis: ≤5.4%, 5.5%-6.4%, 6.5%-7.4%, and ≥7.5%.<h4>Results</h4>Compared with the lowest HbA1c group (≤5.4%), the higher HbA1c groups (5.5%-6.4%, 6.5%-7.4%, and ≥7.5%) were associated with advanced liver fibrosis and high NAFLD activity score (NAS). On multivariate analysis, an HbA1c level of 6.5%- 7.4% group was significantly associated with advanced fibrosis compared with the lowest HbA1c group after adjusting for age, sex, hemoglobin, alanine aminotransferase, and creatinine levels. When further controlling for body mass index and uric acid, total cholesterol, and triglyceride levels, the higher HbA1c groups were significantly associated with advanced fibrosis compared with the lowest HbA1c group. On the other hand, compared with the lowest HbA1c group, the higher HbA1c groups were also associated with a high NAS in both multivariate analyses.<h4>Conclusion</h4>Glycemic control is associated with NAFLD exacerbation, with even a mild deterioration in glycemic control, especially a HbA1c level of 6.5%-7.4%, contributing to NAFLD progression.

KLHL20CCPG1
Also flagged:UNC-51-like kinases 1ULK1serine/threonine kinasesautophagymTORAMPK
Journal Article 2024-02-02 ✓ 3 Snippets Pareek G, Kundu M.
In-Text Gene Mentions

KLHL20

kelch-like family member 20

CCPG1

Show Full Abstract

UNC-51-like kinases 1 and 2 (ULK1/2) are serine/threonine kinases that are best known for their evolutionarily conserved role in the autophagy pathway. Upon sensing the nutrient status of a cell, ULK1/2 integrate signals from upstream cellular energy sensors such as mTOR and AMPK and relay them to the downstream components of the autophagy machinery. ULK1/2 also play indispensable roles in the selective autophagy pathway, removing damaged mitochondria, invading pathogens, and toxic protein aggregates. Additional functions of ULK1/2 have emerged beyond autophagy, including roles in protein trafficking, RNP granule dynamics, and signaling events impacting innate immunity, axon guidance, cellular homeostasis, and cell fate. Therefore, it is no surprise that alterations in ULK1/2 expression and activity have been linked with pathophysiological processes, including cancer, neurological disorders, and cardiovascular diseases. Growing evidence suggests that ULK1/2 function as biological rheostats, tuning cellular functions to intra and extra-cellular cues. Given their broad physiological relevance, ULK1/2 are candidate targets for small molecule activators or inhibitors that may pave the way for the development of therapeutics for the treatment of diseases in humans.

OLFM4
Also flagged:organizationcell differentiationorganellesgene expressionbiomoleculeamyotrophic lateral sclerosis
Journal Article 2024-02-02 ✓ 3 Snippets Zhang J, Zhang L, Gongol B, Hayes J, Borowsky AT, Bailey-Serres J, Girke T.
In-Text Gene Mentions

The specific numeric expression data chosen for this example are the mRNA abundance levels of the OLFM4 and LOC440742 genes from an RNA-seq experiment of human cerebellum and frontal cortex tissues with or without amyotrophic lateral sclerosis (ALS) (43).

The experimental variables, genes (OLFM4 and LOC440742) with and without disease (ALS) are arranged row- and column-wise, respectively.

…levels of theOLFM4and LOC440742 genes…

Show Full Abstract

Visualizing spatial assay data in anatomical images is vital for understanding biological processes in cell, tissue, and organ organizations. Technologies requiring this functionality include traditional one-at-a-time assays, and bulk and single-cell omics experiments, including RNA-seq and proteomics. The <i>spatialHeatmap</i> software provides a series of powerful new methods for these needs, and allows users to work with adequately formatted anatomical images from public collections or custom images. It colors the spatial features (e.g. tissues) annotated in the images according to the measured or predicted abundance levels of biomolecules (e.g. mRNAs) using a color key. This core functionality of the package is called a spatial heatmap plot. Single-cell data can be co-visualized in composite plots that combine spatial heatmaps with embedding plots of high-dimensional data. The resulting spatial context information is essential for gaining insights into the tissue-level organization of single-cell data, or vice versa. Additional core functionalities include the automated identification of biomolecules with spatially selective abundance patterns and clusters of biomolecules sharing similar abundance profiles. To appeal to both non-expert and computational users, <i>spatialHeatmap</i> provides a graphical and a command-line interface, respectively. It is distributed as a free, open-source Bioconductor package (https://bioconductor.org/packages/spatialHeatmap) that users can install on personal computers, shared servers, or cloud systems.

DCC
Also flagged:psychiatric disordersschizophreniafirst-episode psychosisCOL4A2NDNFHRNR
Journal Article 2024-02-02 ✓ 1 Snippet Haroon H, Ho AM, Gupta VK, Dasari S, Sellgren CM, Cervenka S, Engberg G, Eren F, Erhardt S, Sung J, Choi DS.
In-Text Gene Mentions

DCC

Show Full Abstract

Apart from their diagnostic, monitoring, or prognostic utility in clinical settings, molecular biomarkers may be instrumental in understanding the pathophysiology of psychiatric disorders, including schizophrenia. Using untargeted metabolomics, we recently identified eight cerebrospinal fluid (CSF) metabolites unique to first-episode psychosis (FEP) subjects compared to healthy controls (HC). In this study, we sought to investigate the CSF proteomic signatures associated with FEP. We employed 16-plex tandem mass tag (TMT) mass spectrometry (MS) to examine the relative protein abundance in CSF samples of 15 individuals diagnosed with FEP and 15 age-and-sex-matched healthy controls (HC). Multiple linear regression model (MLRM) identified 16 differentially abundant CSF proteins between FEP and HC at p < 0.01. Among them, the two most significant CSF proteins were collagen alpha-2 (IV) chain (COL4A2: standard mean difference [SMD] = -1.12, p = 1.64 × 10<sup>-4</sup>) and neuron-derived neurotrophic factor (NDNF: SMD = -1.03, p = 4.52 × 10<sup>-4</sup>) both of which were down-regulated in FEP subjects compared to HC. We also identified several potential CSF proteins associated with the pathophysiology and the symptom profile and severity in FEP subjects, including COL4A2, NDNF, hornerin (HRNR), contactin-6 (CNTN6), voltage-dependent calcium channel subunit alpha-2/delta-3 (CACNA2D3), tropomyosin alpha-3 chain (TPM3 and TPM4). Moreover, several protein signatures were associated with cognitive performance. Although the results need replication, our exploratory study suggests that CSF protein signatures can be used to increase the understanding of the pathophysiology of psychosis.

NEGR1
Also flagged:behavioralneurological disorderautoantibodiescell adhesion moleculeCas9cell surface proteins
Journal Article 2024-02-02 ✓ 5 Snippets Landa J, Serafim AB, Alba M, Maudes E, Molina-Porcel L, Garcia-Serra A, Mannara F, Dalmau J, Graus F, Sabater L.
In-Text Gene Mentions

Also, Negr1 has been proposed as a biomarker of major depression because CSF Negr1 levels were elevated in patients with this disorder (36).

However, the two IgLON family members, Negr1 (IgLON4) and LSAMP (IgLON3), which showed more behavioral alterations in the KO mouse model, have been implicated in several psychiatric disorders (23, 27, 34).

Recent meta-analyses using the Genome-Wide Association Study (GWAS) have identified a single-nucleotide polymorphism (SNP) of Negr1 gene associated with the diagnosis of major depression (35).

…protein (LSAMP/IgLON3), andneural growth regulator 1growth regulator 1…

…growth regulator 1 (NEGR1/IgLON4).…

Show Full Abstract

<h4>Background</h4>Anti-IgLON5 disease is a neurological disorder characterized by autoantibodies against IgLON5 and pathological evidence of neurodegeneration. IgLON5 is a cell adhesion molecule of unknown function that is highly expressed in the brain. Our aim was to investigate the impact of IgLON5 loss-of-function in evaluating brain morphology, social behavior, and the development of symptoms observed in an IgLON5 knockout (IgLON5-KO) mouse model.<h4>Methods</h4>The IgLON5-KO mice were generated using CRISPR-Cas9 technology. Immunohistochemistry on fixed sagittal brain sections and Western blotting brain lysates were used to confirm IgLON5 silencing and to evaluate the presence of other cell surface proteins. Two- month-old IgLON5-KO and wild-type (WT) mice underwent a comprehensive battery of behavioral tests to assess 1) locomotion, 2) memory, 3) anxiety, 4) social interaction, and 5) depressive-like behavior. Brain sections were examined for the presence of anatomical abnormalities and deposits of hyperphosphorylated tau in young adult (2-month-old) and aged (22-month-old) mice.<h4>Results</h4>Mice did not develop neurological symptoms reminiscent of those seen in patients with anti-IgLON5 disease. Behavioral testing revealed that 2-month-old IgLON5-KO mice showed subtle alterations in motor coordination and balance. IgLON5-KO females exhibited hyperactivity during night and day. Males were observed to have depressive-like behavior and excessive nest-building behavior. Neuropathological studies did not reveal brain morphological alterations or hyperphosphorylated tau deposits.<h4>Conclusion</h4>IgLON5-KO mice showed subtle alterations in behavior and deficits in fine motor coordination but did not develop the clinical phenotype of anti-IgLON5 disease.

HTT
Also flagged:P2X7 receptorsP2X7 receptorP2X7Rselective cation channeladenosinetriphosphate
Journal Article 2024-02-02 ✓ 1 Snippet Zheng H, Liu Q, Zhou S, Luo H, Zhang W.
In-Text Gene Mentions

The primary cause of HD is believed to be the amplification of a CAG repeat in the first exon of the huntingtin gene (HTT), leading to the production of the mutant Huntington’s protein (mHTT) (167).

Show Full Abstract

The P2X7 receptor (P2X7R), a non-selective cation channel modulated by adenosine triphosphate (ATP), localizes to microglia, astrocytes, oligodendrocytes, and neurons in the central nervous system, with the most incredible abundance in microglia. P2X7R partake in various signaling pathways, engaging in the immune response, the release of neurotransmitters, oxidative stress, cell division, and programmed cell death. When neurodegenerative diseases result in neuronal apoptosis and necrosis, ATP activates the P2X7R. This activation induces the release of biologically active molecules such as pro-inflammatory cytokines, chemokines, proteases, reactive oxygen species, and excitotoxic glutamate/ATP. Subsequently, this leads to neuroinflammation, which exacerbates neuronal involvement. The P2X7R is essential in the development of neurodegenerative diseases. This implies that it has potential as a drug target and could be treated using P2X7R antagonists that are able to cross the blood-brain barrier. This review will comprehensively and objectively discuss recent research breakthroughs on P2X7R genes, their structural features, functional properties, signaling pathways, and their roles in neurodegenerative diseases and possible therapies.

HTT
Also flagged:Neurodegenerative diseasesagingamyotrophic lateral sclerosisphotonADPD
Journal Article 2024-02-02 ✓ 2 Snippets Chen C, Qi J, Li Y, Li D, Wu L, Li R, Chen Q, Sun N.
In-Text Gene Mentions

At the molecular level, the pathogenesis of HD is driven by toxicity from the full-length amplified Huntington protein and N-terminal Huntington fragments that are susceptible to hydrolysis-related misfolding, with abnormal HTT intron splicing and the somatic amplification of HTT gene CAG repeats further exacerbating these issues (Tabrizi et al., 2022).

Huntington’s disease (HD) is a neurodegenerative disease caused by multiple CAG (cytosine adenine guanine) repeats in the huntingtin (HTT) gene encoding the huntingtin protein Htt.

Show Full Abstract

Raman scattering is an inelastic light scattering that occurs in a manner reflective of the molecular vibrations of molecular structures and chemical conditions in a given sample of interest. Energy changes in the scattered light can be assessed to determine the vibration mode and associated molecular and chemical conditions within the sample, providing a molecular fingerprint suitable for sample identification and characterization. Raman spectroscopy represents a particularly promising approach to the molecular analysis of many diseases owing to clinical advantages including its instantaneous nature and associated high degree of stability, as well as its ability to yield signal outputs corresponding to a single molecule type without any interference from other molecules as a result of its narrow peak width. This technology is thus ideally suited to the simultaneous assessment of multiple analytes. Neurodegenerative diseases represent an increasingly significant threat to global public health owing to progressive population aging, imposing a severe physical and social burden on affected patients who tend to develop cognitive and/or motor deficits beginning between the ages of 50 and 70. Owing to a relatively limited understanding of the etiological basis for these diseases, treatments are lacking for the most common neurodegenerative diseases, which include Alzheimer's disease, Parkinson's disease, Huntington's disease, and amyotrophic lateral sclerosis. The present review was formulated with the goal of briefly explaining the principle of Raman spectroscopy and discussing its potential applications in the diagnosis and evaluation of neurodegenerative diseases, with a particular emphasis on the research prospects of this novel technological platform.

Also flagged:synapseslocomotioncognitionsynaptic junctionsynaptic vesiclesmembrane
Journal Article 2024-02-02 No Snippets Wang M, Fan J, Shao Z.
Show Full Abstract

Chemical synapses are essential for neuronal information storage and relay. The synaptic signal received or sent from spatially distinct subcellular compartments often generates different outcomes due to the distance or physical property difference. Therefore, the final output of postsynaptic neurons is determined not only by the type and intensity of synaptic inputs but also by the synaptic subcellular location. How synaptic subcellular specificity is determined has long been the focus of study in the neurodevelopment field. Genetic studies from invertebrates such as <i>Caenorhabditis elegans</i> (<i>C. elegans</i>) have uncovered important molecular and cellular mechanisms required for subcellular specificity. Interestingly, similar molecular mechanisms were found in the mammalian cerebellum, hippocampus, and cerebral cortex. This review summarizes the comprehensive advances in the cellular and molecular mechanisms underlying synaptic subcellular specificity, focusing on studies from <i>C. elegans</i> and rodents.

Also flagged:neuromuscular disordersnarcolepsyhereditary sensory neuropathy type 1Eneuromuscular disorderneuropathyHADHB
Journal Article 2024-02-02 No Snippets Dratch L, Bardakjian TM, Johnson K, Babaian N, Gonzalez-Alegre P, Elman L, Quinn C, Guo MH, Scherer SS, Amado DA.
Show Full Abstract

Advances in gene-specific therapeutics for patients with neuromuscular disorders (NMDs) have brought increased attention to the importance of genetic diagnosis. Genetic testing practices vary among adult neuromuscular clinics, with multi-gene panel testing currently being the most common approach; follow-up testing using broad-based methods, such as exome or genome sequencing, is less consistently offered. Here, we use five case examples to illustrate the unique ability of broad-based testing to improve diagnostic yield, resulting in identification of <i>SORD-</i>neuropathy, <i>HADHB</i>-related disease, <i>ATXN2</i>-ALS, <i>MECP2</i> related progressive gait decline and spasticity, and <i>DNMT1</i>-related cerebellar ataxia, deafness, narcolepsy, and hereditary sensory neuropathy type 1E. We describe in each case the technological advantages that enabled identification of the causal gene, and the resultant clinical and personal implications for the patient, demonstrating the importance of offering exome or genome sequencing to adults with NMDs.

DCC
Also flagged:Diabetes Mellitusdiabetesmethylationhistoneobesitygestational diabetes mellitus
Journal Article 2024-02-02 ✓ 1 Snippet Meza-León A, Montoya-Estrada A, Reyes-Muñoz E, Romo-Yáñez J.
In-Text Gene Mentions

…signaling 12 (RGS12),immunoglobulin superfamily DCC subclass member 3superfamily DCC subclass…

Show Full Abstract

Worldwide, diabetes mellitus represents a growing health problem. If it occurs during pregnancy, it can increase the risk of various abnormalities in early and advanced life stages of exposed individuals due to fetal programming occurring in utero. Studies have determined that maternal conditions interfere with the genotypes and phenotypes of offspring. Researchers are now uncovering the mechanisms by which epigenetic alterations caused by diabetes affect the expression of genes and, therefore, the development of various diseases. Among the numerous possible epigenetic changes in this regard, the most studied to date are DNA methylation and hydroxymethylation, as well as histone acetylation and methylation. This review article addresses critical findings in epigenetic studies involving diabetes mellitus, including variations reported in the expression of specific genes and their transgenerational effects.

HTT
Also flagged:nucleoproteinautophagy-inducingpeptideNPAIPantibody
Journal Article 2024-02-02 ✓ 1 Snippet Sayedahmed EE, Elshafie NO, Dos Santos AP, Jagannath C, Sambhara S, Mittal SK.
In-Text Gene Mentions

…Tmem74, Bid, Irgm1,Htt, Ifng, and Tnf…

Show Full Abstract

The nucleoprotein (NP) is a vital target for the heterosubtypic immunity of CD8<sup>+</sup> cytotoxic T lymphocytes (CTLs) due to its conservation among influenza virus subtypes. To further enhance the T cell immunity of NP, autophagy-inducing peptide C5 (AIP-C5) from the CFP10 protein of <i>Mycobacterium tuberculosis</i> was used. Mice were immunized intranasally (i.n.) with human adenoviral vectors, HAd-C5-NP(H7N9) or HAd-NP(H7N9), expressing NP of an H7N9 influenza virus with or without the AIP-C5, respectively. Both vaccines developed similar levels of NP-specific systemic and mucosal antibody titers; however, there was a significantly higher number of NP-specific CD8 T cells secreting interferon-gamma (IFN-γ) in the HAd-C5-NP(H7N9) group than in the HAd-NP(H7N9) group. The HAd-C5-NP(H7N9) vaccine provided better protection following the challenge with A/Puerto Rico/8/1934(H1N1), A/Hong Kong/1/68(H3N2), A/chukkar/MN/14951-7/1998(H5N2), A/goose/Nebraska/17097/2011(H7N9), or A/Hong Kong/1073/1999(H9N2) influenza viruses compared to the HAd-NP(H7N9) group. The autophagy transcriptomic gene analysis of the HAd-C5-NP(H7N9) group revealed the upregulation of some genes involved in the positive regulation of the autophagy process. The results support further exploring the use of NP and AIP-C5 for developing a universal influenza vaccine for pandemic preparedness.

HFE
Also flagged:FerritinNonalcoholic Fatty Liver DiseaseNAFLDnonalcoholic steatohepatitisNASHnonalcoholic fatty liver
Journal Article 2024-02-02 ✓ 2 Snippets Makri E, Orfanidou M, Makri ES, Goulas A, Terpos E, Polyzos SA.
In-Text Gene Mentions

hemochromatosis

HFE

Show Full Abstract

<h4>Objectives</h4>To synthesize data on circulating ferritin between patients with histologically confirmed nonalcoholic fatty liver disease (NAFLD) and non-NAFLD controls.<h4>Methods</h4>A systematic literature search was conducted in PubMed, Scopus, and the Cochrane Library. Thirty-one studies comprising data on 5631 individuals (2929 biopsy-proven NAFLD patients and 2702 controls) were included in the meta-analysis.<h4>Results</h4>Higher circulating ferritin levels were observed in NAFLD patients than in controls [standardized mean difference (SMD) 1.14; 95% confidence interval (95% CI) 0.73-1.55], in patients with simple nonalcoholic fatty liver (NAFL) than in controls (SMD 0.57; 95% CI 0.34-0.80), in patients with nonalcoholic steatohepatitis (NASH) than in controls (SMD 0.95; 95% CI 0.69-1.22), and in NASH than in NAFL patients (SMD 0.62; 95% CI 0.25-0.99). There was moderate-to-high heterogeneity among studies in the above pairs of comparisons (<i>I</i><sup>2</sup> = 68-97%); no risk of publication bias was observed by Egger's test (<i>P</i> = 0.81, <i>P</i> = 0.72, <i>P</i> = 0.59, <i>P</i> = 0.42, respectively). The heterogeneity was reduced in the subgroup of biopsy-proven controls in all pairs of comparisons (<i>I</i><sup>2</sup> = 0-65%). The heterogeneity was also reduced after excluding studies with the Newcastle-Ottawa Scale (NOS) score <7 (<i>n</i> = 10) for the comparison of NAFLD patients vs. controls (<i>I</i><sup>2</sup> = 54%, <i>P</i> = 0.02). The meta-regression analysis revealed that the male ratio was positively associated with ferritin SMD in the comparison between NAFLD patients and controls and accounted for 32.7% (<i>P</i> = 0.002) of the heterogeneity in this pair of comparison.<h4>Conclusions</h4>Circulating ferritin was higher in NAFLD (or NAFL or NASH) patients compared with controls. Higher levels of circulating ferritin were also associated with the severity of the disease, which, however, should be cautiously interpreted.<b>PROSPERO registration ID</b>: CRD42022354025.

Also flagged:Acute Renal Injurytubulointerstitial diseasesimmune-related conditionsbasekidney function insufficiencyADTKD
Journal Article 2024-02-02 No Snippets Li J, Hou F, Lv N, Zhao R, Zhang L, Yue C, Nie M, Chen L.
Show Full Abstract

<h4>Background</h4>Acute kidney injury (AKI) is a severe condition marked by rapid renal function deterioration and elevated mortality, with traditional biomarkers lacking sensitivity and specificity. Rare tubulointerstitial diseases encompass a spectrum of disorders, primarily including monogenic diseases, immune-related conditions, and drug-induced tubulointerstitial diseases. The clinical manifestations vary from electrolyte and acid-base imbalances to kidney function insufficiency, which is associated with AKI in up to 20% of cases. Evidence indicated that rare tubulointerstitial diseases might provide new conceptual insights and perspectives for novel biomarkers and potential therapeutic strategies for AKI.<h4>Summary</h4>Autosomal dominant tubulointerstitial kidney disease (ADTKD) and Fanconi syndrome (FS) are rare tubulointerstitial diseases. In ADTKD, UMOD and REN are closely related to AKI by affecting oxidative stress and tubuloglomerular feedback, which provide potential new biomarkers for AKI. Both rare tubulointerstitial diseases and AKI share etiologies and treatment responses. From the mechanism standpoint, rare tubulointerstitial diseases and AKI involve tubular transporter injury, initially manifesting as tubular dysfunction in tubulointerstitial disorder and progressing to AKI because of the programmed cell death with apoptosis, pyroptosis, or necroptosis of proximal tubule cells. Additionally, mitochondrial dysfunction has been identified as a common mechanism in both tubulointerstitial diseases and AKI induced by drugs, pSS, or monoclonal diseases. In the end, both AKI and FS patients and animal models responded well to the therapy of the primary diseases.<h4>Key messages</h4>In this review, we describe an overview of ADTKD and FS to identify their associations with AKI. Mitochondrial dysfunction contributes to rare tubulointerstitial diseases and AKI, which might provide a potential therapeutic target.

STAU1
Also flagged:RNA-binding protein FUSTDP-43FUSmRNA-binding proteinsnucleuscytoplasmic
Journal Article 2024-02-02 ✓ 1 Snippet Demongin C, Tranier S, Joshi V, Ceschi L, Desforges B, Pastré D, Hamon L.
In-Text Gene Mentions

…some RBPs likeSTAU1or SMN can…

Show Full Abstract

No abstract available.

SERPINC1
Also flagged:dementiaACEcognitioncognitive impairmentbehaviouralFrontotemporal Dementia
Journal Article 2024-02-01 ✓ 1 Snippet McCarthy L, Rubinsztein J, Lowry E, Flanagan E, Menon V, Vearncombe S, Mioshi E, Hornberger M.
In-Text Gene Mentions

…= 5.7);ACE-III, 63.7 (s.d.…

Show Full Abstract

<h4>Aims and method</h4>We aimed to establish cut-off scores to stage dementia on the Addenbrooke's Cognitive Examination-III (ACE-III) and the Mini-Addenbrooke's Cognitive Examination (M-ACE) compared with scores traditionally used with the Mini-Mental State Examination (MMSE). Our cross-sectional study recruited 80 patients and carers from secondary care services in the UK.<h4>Results</h4>A score ≤76 on the ACE-III and ≤19 on the M-ACE correlated well with MMSE cut-offs for mild dementia, with a good fit on the receiver operating characteristic analysis for both the ACE-III and M-ACE. The cut-off for moderate dementia had lower sensitivity and specificity. There were low to moderate correlations between the cognitive scales and scales for everyday functioning and behaviour.<h4>Clinical implications</h4>Our findings allow an objective interpretation of scores on the ACE-III and the M-ACE relative to the MMSE, which may be helpful for clinical services and research trials.

POU3F2
Also flagged:brain developmentasymmetric cell divisionsneurogenesisgliogenesisgene expressionHes5
Journal Article 2024-02-01 ✓ 1 Snippet Mukhtar T, Taylor V.
In-Text Gene Mentions

…2+ (deep-layer) and Pou3f2+ (upper-layer) neur…

Show Full Abstract

No abstract available.

SOX6
Also flagged:gelatindifferentiationdigestioncell differentiationaxonalPD
Journal Article 2024-02-01 ✓ 1 Snippet Feng L, Li D, Tian Y, Zhao C, Sun Y, Kou X, Wu J, Wang L, Gu Q, Li W, Hao J, Hu B, Wang Y.
In-Text Gene Mentions

…Notably, mDAPs expressedSOX6and GIRK2 ,…

Show Full Abstract

Numerous studies have shown that cell replacement therapy can replenish lost cells and rebuild neural circuitry in animal models of Parkinson's disease. Transplantation of midbrain dopaminergic progenitor cells is a promising treatment for Parkinson's disease. However, transplanted cells can be injured by mechanical damage during handling and by changes in the transplantation niche. Here, we developed a one-step biomanufacturing platform that uses small-aperture gelatin microcarriers to produce beads carrying midbrain dopaminergic progenitor cells. These beads allow midbrain dopaminergic progenitor cell differentiation and cryopreservation without digestion, effectively maintaining axonal integrity in vitro. Importantly, midbrain dopaminergic progenitor cell bead grafts showed increased survival and only mild immunoreactivity in vivo compared with suspended midbrain dopaminergic progenitor cell grafts. Overall, our findings show that these midbrain dopaminergic progenitor cell beads enhance the effectiveness of neuronal cell transplantation.

DCC
Also flagged:Breast cancercancerBRCA1BRCA2breast cancersepithelial cell differentiation
Journal Article 2024-02-01 ✓ 1 Snippet Caputo A, Vipparthi K, Bazeley P, Downs-Kelly E, McIntire P, Duckworth LA, Ni Y, Hu B, Keri RA, Karaayvaz M.
In-Text Gene Mentions

DCC

Show Full Abstract

Breast cancer is the most common cancer in females, affecting one in every eight women and accounting for the majority of cancer-related deaths in women worldwide. Germline mutations in the BRCA1 and BRCA2 genes are significant risk factors for specific subtypes of breast cancer. BRCA1 mutations are associated with basal-like breast cancers, whereas BRCA2 mutations are associated with luminal-like disease. Defects in mammary epithelial cell differentiation have been previously recognized in germline BRCA1/2 mutation carriers even before cancer incidence. However, the underlying mechanism is largely unknown. Here, we employ spatial transcriptomics to investigate defects in mammary epithelial cell differentiation accompanied by distinct microenvironmental alterations in preneoplastic breast tissues from BRCA1/2 mutation carriers and normal breast tissues from noncarrier controls. We uncovered spatially defined receptor-ligand interactions in these tissues for the investigation of autocrine and paracrine signaling. We discovered that β1-integrin-mediated autocrine signaling in BRCA2-deficient mammary epithelial cells may differ from BRCA1-deficient mammary epithelial cells. In addition, we found that the epithelial-to-stromal paracrine signaling in the breast tissues of BRCA1/2 mutation carriers is greater than in control tissues. More integrin-ligand pairs were differentially correlated in BRCA1/2-mutant breast tissues than noncarrier breast tissues with more integrin receptor-expressing stromal cells.<h4>Implications</h4>These results suggest alterations in the communication between mammary epithelial cells and the microenvironment in BRCA1 and BRCA2 mutation carriers, laying the foundation for designing innovative breast cancer chemo-prevention strategies for high-risk patients.

NEGR1
Also flagged:chronic diseasesobesitytype 2 diabetesinsulinCreatine kinasesendothelial adhesion molecules
Journal Article 2024-02-01 ✓ 5 Snippets Steffen BT, McDonough DJ, Pankow JS, Tang W, Rooney MR, Demmer RT, Lutsey PL, Guan W, Gabriel KP, Palta P, Moser ED, Pereira MA.
In-Text Gene Mentions

Of the dozens of PA-associated circulating proteins identified and confirmed in this study, 18 were related to incident T2D, and two-sample MR showed that NeGR1 may be a protective factor against T2D.

A single cis-acting pQTL for NeGR1, rs1026566, was tested and showed a stronger association with T2D than the six pQTL instrument (OR per SD 0.80; P = 6.3 × 10−5).

Significantly lower proportions of Black participants, current smokers, and individuals taking blood pressure and cholesterol medication were evident across successive quintiles of plasma NeGR1 concentrations.

Two-sample MR analysis identified higher plasma NeGR1 as a causal protective factor against T2D pathogenesis.

Genome-wide association studies have further identified variants in NEGR1 associated with BMI and obesity (18,19), suggesting that the NEGR1 gene is one of many genetic determinants of adiposity.

Show Full Abstract

Habitual physical activity (PA) impacts the plasma proteome and reduces the risk of developing type 2 diabetes (T2D). Using a large-scale proteome-wide approach in Atherosclerosis Risk in Communities study participants, we aimed to identify plasma proteins associated with PA and determine which of these may be causally related to lower T2D risk. PA was associated with 92 plasma proteins in discovery (P < 1.01 × 10-5), and 40 remained significant in replication (P < 5.43 × 10-4). Eighteen of these proteins were independently associated with incident T2D (P < 1.25 × 10-3), including neuronal growth regulator 1 (NeGR1; hazard ratio per SD 0.85; P = 7.5 × 10-11). Two-sample Mendelian randomization (MR) inverse variance weighted analysis indicated that higher NeGR1 reduces T2D risk (odds ratio [OR] per SD 0.92; P = 0.03) and was consistent with MR-Egger, weighted median, and weighted mode sensitivity analyses. A stronger association was observed for the single cis-acting NeGR1 genetic variant (OR per SD 0.80; P = 6.3 × 10-5). Coupled with previous evidence that low circulating NeGR1 levels promote adiposity, its association with PA and potential causal role in T2D shown here suggest that NeGR1 may link PA exposure with metabolic outcomes. Further research is warranted to confirm our findings and examine the interplay of PA, NeGR1, adiposity, and metabolic health.<h4>Article highlights</h4>

HTT
Also flagged:Huntington diseaseHDcognitionneurodegenerative disorderautosomalHuntingtin
Journal Article 2024-02-01 ✓ 1 Snippet Wang Y, Ramandi D, Sepers MD, Mackay JP, Raymond LA.
In-Text Gene Mentions

Htt

Show Full Abstract

The neurodegenerative disorder, Huntington disease (HD), manifests as disorders of movement, cognition and mood. Although studies report abnormal corticostriatal synaptic function early in HD mouse models, less is known about cortical-cortical activity across brain regions and disease stages. Recently, we reported enhanced mesoscale spread of cortical responses to sensory stimulation in vivo at early-manifest stages of two HD mouse models. Here, we investigated cortical excitability of zQ175 HD-model mice compared to their wild-type littermates across different cell types, ages and/or cortical regions using ex vivo electrophysiology. Cortical pyramidal neurons (CPNs) in somatosensory cortex of zQ175 mice showed intrinsic hyper-excitability at 3-4 months, but hypo-excitability at early-manifest stage (8-9 months); reduced frequency of spontaneous excitatory postsynaptic currents (sEPSCs) was seen at both ages. In contrast, motor cortex CPNs in early-manifest zQ175 mice showed increased intrinsic excitability and sEPSC frequency. Large-amplitude excitatory discharges recorded from CPNs in early-manifest zQ175 mice showed increased frequency only in somatosensory cortex, suggesting the intrinsic hypo-excitability of these CPNs may be compensatory against cortical network hyper-excitability. Similarly, in early-manifest zQ175 mice, region-dependent differences were seen in fast-spiking interneurons (FSIs): somatosensory but not motor FSIs from early-manifest zQ175 mice had reduced intrinsic excitability. Moreover, CPNs showed decreased frequency of spontaneous inhibitory postsynaptic currents and increased excitatory-inhibitory (E-I) balance of evoked synaptic currents in somatosensory cortex. Aberrant large-amplitude discharges and reduced inhibitory drive may therefore underlie E-I imbalances that result in circuit changes and synaptic dysfunction in early-manifest HD.

TRIM38
Also flagged:gene expressionimmune cell developmentimmune responseNLRPLRpathogenesis
Journal Article 2024-02-01 ✓ 4 Snippets Leonard S, Karabegović I, Ikram MA, Ahmad S, Ghanbari M.
In-Text Gene Mentions

…HBS1L, MYB, andTRIM38.…

…and miR-34b-3p targetsTRIM38.…

…Moreover, ZNRF3 andTRIM38genes did not…

…regulatory role ofTRIM38in innate immunity…

Show Full Abstract

MicroRNAs (miRNAs) are small non-coding RNAs that post-transcriptionally regulate gene expression and different immune-related pathways. There is a great interest in identifying miRNAs involved in immune cell development and function to elucidate the biological mechanisms underlying the immune system, its regulation, and disease. In this study, we aimed to investigate the association of circulating miRNAs with blood cell compositions and blood-based immune markers. Circulating levels of 2083 miRNAs were measured by RNA-sequencing in plasma samples of 1999 participants from the population-based Rotterdam Study collected between 2002 and 2005. Full blood count measurements were performed for absolute granulocyte, platelet, lymphocyte, monocyte, white, and red blood cell counts. Multivariate analyses were performed to test the association of miRNAs with blood cell compositions and immune markers. We evaluated the overlap between predicted target genes of candidate miRNAs associated with immune markers and genes determining the blood immune response markers. First, principal component regression analysis showed that plasma levels of circulating miRNAs were significantly associated with red blood cell, granulocyte, and lymphocyte counts. Second, the cross-sectional analysis identified 210 miRNAs significantly associated (P < 2.82 × 10-5) with neutrophil-to-lymphocyte ratio (NLR), platelet-to-lymphocyte ratio (PLR), and systemic immune-inflammation index. Further genetic look-ups showed that target genes of seven identified miRNAs (miR-1233-3p, miR-149-3p, miR-150-5p, miR-342-3p, miR-34b-3p, miR-4644, and miR-7106-5p) were also previously linked to NLR and PLR markers. Collectively, our study suggests several circulating miRNAs that regulate the innate and adaptive immune systems, providing insight into the pathogenesis of miRNAs in immune-related diseases and paving the way for future clinical applications.

PRDX6
Also flagged:Alexander diseaseneurodegenerative disorderGFAPastrocyte diseasepathogenesisIba1
Journal Article 2024-02-01 ✓ 2 Snippets Saito K, Shigetomi E, Shinozaki Y, Kobayashi K, Parajuli B, Kubota Y, Sakai K, Miyakawa M, Horiuchi H, Nabekura J, Koizumi S.
In-Text Gene Mentions

…, Mt1 ,Prdx6, Prdx1 ,…

…, Mt1 ,Prdx6and Prdx1 were…

Show Full Abstract

Alexander disease (AxD) is an intractable neurodegenerative disorder caused by GFAP mutations. It is a primary astrocyte disease with a pathological hallmark of Rosenthal fibres within astrocytes. AxD astrocytes show several abnormal phenotypes. Our previous study showed that AxD astrocytes in model mice exhibit aberrant Ca2+ signals that induce AxD aetiology. Here, we show that microglia have unique phenotypes with morphological and functional alterations, which are related to the pathogenesis of AxD. Immunohistochemical studies of 60TM mice (AxD model) showed that AxD microglia exhibited highly ramified morphology. Functional changes in microglia were assessed by Ca2+ imaging using hippocampal brain slices from Iba1-GCaMP6-60TM mice and two-photon microscopy. We found that AxD microglia showed aberrant Ca2+ signals, with high frequency Ca2+ signals in both the processes and cell bodies. These microglial Ca2+ signals were inhibited by pharmacological blockade or genetic knockdown of P2Y12 receptors but not by tetrodotoxin, indicating that these signals are independent of neuronal activity but dependent on extracellular ATP from non-neuronal cells. Our single-cell RNA sequencing data showed that the expression level of Entpd2, an astrocyte-specific gene encoding the ATP-degrading enzyme NTPDase2, was lower in AxD astrocytes than in wild-type astrocytes. In situ ATP imaging using the adeno-associated virus vector GfaABC1D ATP1.0 showed that exogenously applied ATP was present longer in 60TM mice than in wild-type mice. Thus, the increased ATP level caused by the decrease in its metabolizing enzyme in astrocytes could be responsible for the enhancement of microglial Ca2+ signals. To determine whether these P2Y12 receptor-mediated Ca2+ signals in AxD microglia play a significant role in the pathological mechanism, a P2Y12 receptor antagonist, clopidogrel, was administered. Clopidogrel significantly exacerbated pathological markers in AxD model mice and attenuated the morphological features of microglia, suggesting that microglia play a protective role against AxD pathology via P2Y12 receptors. Taken together, we demonstrated that microglia sense AxD astrocyte dysfunction via P2Y12 receptors as an increase in extracellular ATP and alter their morphology and Ca2+ signalling, thereby protecting against AxD pathology. Although AxD is a primary astrocyte disease, our study may facilitate understanding of the role of microglia as a disease modifier, which may contribute to the clinical diversity of AxD.

DARS2
Also flagged:Mitochondrial aminoacyl-tRNA synthetasesmt-ARSmitochondrialphosphorylationMitochondrial aminoacyl-tRNA synthetaseAARS2
Journal Article 2024-02-01 ✓ 3 Snippets Podmanicky O, Gao F, Munro B, Jennings MJ, Boczonadi V, Hathazi D, Mueller JS, Horvath R.
In-Text Gene Mentions

Paradoxically, all mt-ARS are present in each cell, but their mutations affect different cells and organs, most frequently the brain, leading to leukoencephalopathy with thalamus and brainstem involvement and high level of lactate (mitochondrial glutamyl-tRNA synthetase, EARS2), leukoencephalopathy with brain stem and spinal cord involvement and lactate elevation (mitochondrial aspartyl-tRNA synthetase, DARS2), leukoencephalopathy with ovarian failure (mitochondrial alanyl-tRNA synthetase, AARS2), pontocerebellar hypoplasia (mitochondrial arginyl-tRNA synthetase, RARS2) or epileptic encephalopathy (mitochondrial phenylalanyl-tRNA synthetase, FARS2, and mitochondrial cysteinyl-tRNA synthetase, CARS2).

…rial aspartyl-tRNA synthetase,DARS2) , leukoencephalopathy with…

…in the heart-specificDars2knock-out mice, suggesting…

Show Full Abstract

Mitochondrial aminoacyl-tRNA synthetase (mt-ARS) mutations cause severe, progressive, and often lethal diseases with highly heterogeneous and tissue-specific clinical manifestations. This study investigates the molecular mechanisms triggered by three different mt-ARS defects caused by biallelic mutations in AARS2, EARS2, and RARS2, using an in vitro model of human neuronal cells. We report distinct molecular mechanisms of mitochondrial dysfunction among the mt-ARS defects studied. Our findings highlight the ability of proliferating neuronal progenitor cells (iNPCs) to compensate for mitochondrial translation defects and maintain balanced levels of oxidative phosphorylation (OXPHOS) components, which becomes more challenging in mature neurons. Mutant iNPCs exhibit unique compensatory mechanisms, involving specific branches of the integrated stress response, which may be gene-specific or related to the severity of the mitochondrial translation defect. RNA sequencing revealed distinct transcriptomic profiles showing dysregulation of neuronal differentiation and protein translation. This study provides valuable insights into the tissue-specific compensatory mechanisms potentially underlying the phenotypes of patients with mt-ARS defects. Our novel in vitro model may more accurately represent the neurological presentation of patients and offer an improved platform for future investigations and therapeutic development.

PCDH17
Also flagged:pathogenesisendothelial dysfunctionangiogenesisadhesion moleculescancerpulmonary hypertension
Journal Article 2024-02-01 ✓ 1 Snippet Piper B, Bogamuwa S, Hossain T, Farkas D, Rosas L, Green AC, Newcomb G, Sun N, Ovando-Ricardez JA, Horowitz JC, Bhagwani AR, Yang H, Kudryashova TV, Rojas M, Mora AL, Yan P, Mallampalli RK, Goncharova EA, Eckmann DM, Farkas L.
In-Text Gene Mentions

…the antiangiogenic genesPCDH17, IGFBP6 ,…

Show Full Abstract

Pulmonary arterial hypertension (PAH) is a devastating and progressive disease with limited treatment options. Endothelial dysfunction plays a central role in the development and progression of PAH, yet the underlying mechanisms are incompletely understood. The endosome-lysosome system is important to maintain cellular health, and the small GTPase RAB7 regulates many functions of this system. Here, we explored the role of RAB7 in endothelial cell (EC) function and lung vascular homeostasis. We found reduced expression of RAB7 in ECs from patients with PAH. Endothelial haploinsufficiency of RAB7 caused spontaneous pulmonary hypertension (PH) in mice. Silencing of RAB7 in ECs induced broad changes in gene expression revealed via RNA-Seq, and RAB7-silenced ECs showed impaired angiogenesis and expansion of a senescent cell fraction, combined with impaired endolysosomal trafficking and degradation, suggesting inhibition of autophagy at the predegradation level. Furthermore, mitochondrial membrane potential and oxidative phosphorylation were decreased, and glycolysis was enhanced. Treatment with the RAB7 activator ML-098 reduced established PH in rats with chronic hypoxia/SU5416. In conclusion, we demonstrate for the first time to our knowledge the fundamental impairment of EC function by loss of RAB7, causing PH, and show RAB7 activation to be a potential therapeutic strategy in a preclinical model of PH.

DNAH10
Also flagged:bronchiolar diseasegene expressionmucusmucinIL-1αIL-1β
Journal Article 2024-02-01 ✓ 1 Snippet Asakura T, Okuda K, Chen G, Dang H, Kato T, Mikami Y, Schworer SA, Gilmore RC, Radicioni G, Hawkins P, Barbosa Cardenas SM, Saito M, Cawley AM, De la Cruz G, Chua M, Alexis NE, Masugi Y, Noone PG, Ribeiro CMP, Kesimer M, Olivier KN, Hasegawa N, Randell SH, O'Neal WK, Boucher RC.
In-Text Gene Mentions

DNAH10

Show Full Abstract

<b>Rationale:</b> Non-cystic fibrosis bronchiectasis (NCFB) may originate in bronchiolar regions of the lung. Accordingly, there is a need to characterize the morphology and molecular characteristics of NCFB bronchioles. <b>Objectives:</b> Test the hypothesis that NCFB exhibits a major component of bronchiolar disease manifest by mucus plugging and ectasia. <b>Methods:</b> Morphologic criteria and region-specific epithelial gene expression, measured histologically and by RNA <i>in situ</i> hybridization and immunohistochemistry, identified proximal and distal bronchioles in excised NCFB lungs. RNA <i>in situ</i> hybridization and immunohistochemistry assessed bronchiolar mucus accumulation and mucin gene expression. CRISPR-Cas9-mediated IL-1R1 knockout in human bronchial epithelial cultures tested IL-1α and IL-1β contributions to mucin production. Spatial transcriptional profiling characterized NCFB distal bronchiolar gene expression. <b>Measurements and Main Results:</b> Bronchiolar perimeters and lumen areas per section area were increased in proximal, but not distal, bronchioles in NCFB versus control lungs, suggesting proximal bronchiolectasis. In NCFB, mucus plugging was observed in ectatic proximal bronchioles and associated nonectatic distal bronchioles in sections with disease. MUC5AC and MUC5B mucins were upregulated in NCFB proximal bronchioles, whereas MUC5B was selectively upregulated in distal bronchioles. Bronchiolar mucus plugs were populated by IL-1β-expressing macrophages. NCFB sterile sputum supernatants induced human bronchial epithelial MUC5B and MUC5AC expression that was >80% blocked by IL-1R1 ablation. Spatial transcriptional profiling identified upregulation of genes associated with secretory cells, hypoxia, interleukin pathways, and IL-1β-producing macrophages in mucus plugs and downregulation of epithelial ciliogenesis genes. <b>Conclusions:</b> NCFB exhibits distinctive proximal and distal bronchiolar disease. Both bronchiolar regions exhibit bronchiolar secretory cell features and mucus plugging but differ in mucin gene regulation and ectasia.

MLLT10
Also flagged:acute myeloid leukemiaAMLAF10leukemiachromatinCRISPR
Journal Article 2024-02-01 ✓ 1 Snippet Barbosa K, Deshpande A, Perales M, Xiang P, Murad R, Pramod AB, Minkina A, Robertson N, Schischlik F, Lei X, Sun Y, Brown A, Amend D, Jeremias I, Doench JG, Humphries RK, Ruppin E, Shendure J, Mali P, Adams PD, Deshpande AJ.
In-Text Gene Mentions

MLLT10

Show Full Abstract

<h4>Abstract</h4>Aberrant expression of stem cell-associated genes is a common feature in acute myeloid leukemia (AML) and is linked to leukemic self-renewal and therapy resistance. Using AF10-rearranged leukemia as a prototypical example of the recurrently activated "stemness" network in AML, we screened for chromatin regulators that sustain its expression. We deployed a CRISPR-Cas9 screen with a bespoke domain-focused library and identified several novel chromatin-modifying complexes as regulators of the TALE domain transcription factor MEIS1, a key leukemia stem cell (LSC)-associated gene. CRISPR droplet sequencing revealed that many of these MEIS1 regulators coordinately controlled the transcription of several AML oncogenes. In particular, we identified a novel role for the Tudor-domain-containing chromatin reader protein SGF29 in the transcription of AML oncogenes. Furthermore, SGF29 deletion impaired leukemogenesis in models representative of multiple AML subtypes in multiple AML subtype models. Our studies reveal a novel role for SGF29 as a nononcogenic dependency in AML and identify the SGF29 Tudor domain as an attractive target for drug discovery.

DARS2
Also flagged:mitochondrialnuclear genomecytosolmitochondriaMTO1GTPBP3
Journal Article 2024-02-01 ✓ 1 Snippet Ahmad RNR, Zhang LT, Morita R, Tani H, Wu Y, Chujo T, Ogawa A, Harada R, Shigeta Y, Tomizawa K, Wei FY.
In-Text Gene Mentions

…cardiac phenotypes ofDars2knockout mice, a…

Show Full Abstract

MTU1 controls intramitochondrial protein synthesis by catalyzing the 2-thiouridine modification of mitochondrial transfer RNAs (mt-tRNAs). Missense mutations in the MTU1 gene are associated with life-threatening reversible infantile hepatic failure. However, the molecular pathogenesis is not well understood. Here, we investigated 17 mutations associated with this disease, and our results showed that most disease-related mutations are partial loss-of-function mutations, with three mutations being particularly severe. Mutant MTU1 is rapidly degraded by mitochondrial caseinolytic peptidase (CLPP) through a direct interaction with its chaperone protein CLPX. Notably, knockdown of CLPP significantly increased mutant MTU1 protein expression and mt-tRNA 2-thiolation, suggesting that accelerated proteolysis of mutant MTU1 plays a role in disease pathogenesis. In addition, molecular dynamics simulations demonstrated that disease-associated mutations may lead to abnormal intermolecular interactions, thereby impairing MTU1 enzyme activity. Finally, clinical data analysis underscores a significant correlation between patient prognosis and residual 2-thiolation levels, which is partially consistent with the AlphaMissense predictions. These findings provide a comprehensive understanding of MTU1-related diseases, offering prospects for modification-based diagnostics and novel therapeutic strategies centered on targeting CLPP.

Also flagged:Myelodysplastic syndromeacute myeloid leukemiaAMLchromosomemyeloid neoplasmsTP53
Journal Article 2024-02-01 No Snippets Fuchs SNR, Stalmann USA, Snoeren IAM, Bindels E, Schmitz S, Banjanin B, Hoogenboezem RM, van Herk S, Saad M, Walter W, Haferlach T, Seillier L, Saez-Rodriguez J, Dugourd AJF, Lehmann KV, Ben-Neriah Y, Gleitz HFE, Schneider RK.
Show Full Abstract

<h4>Abstract</h4>It is still not fully understood how genetic haploinsufficiency in del(5q) myelodysplastic syndrome (MDS) contributes to malignant transformation of hematopoietic stem cells. We asked how compound haploinsufficiency for Csnk1a1 and Egr1 in the common deleted region on chromosome 5 affects hematopoietic stem cells. Additionally, Trp53 was disrupted as the most frequently comutated gene in del(5q) MDS using CRISPR/Cas9 editing in hematopoietic progenitors of wild-type (WT), Csnk1a1-/+, Egr1-/+, Csnk1a1/Egr1-/+ mice. A transplantable acute leukemia only developed in the Csnk1a1-/+Trp53-edited recipient. Isolated blasts were indefinitely cultured ex vivo and gave rise to leukemia after transplantation, providing a tool to study disease mechanisms or perform drug screenings. In a small-scale drug screening, the collaborative effect of Csnk1a1 haploinsufficiency and Trp53 sensitized blasts to the CSNK1 inhibitor A51 relative to WT or Csnk1a1 haploinsufficient cells. In vivo, A51 treatment significantly reduced blast counts in Csnk1a1 haploinsufficient/Trp53 acute leukemias and restored hematopoiesis in the bone marrow. Transcriptomics on blasts and their normal counterparts showed that the derived leukemia was driven by MAPK and Myc upregulation downstream of Csnk1a1 haploinsufficiency cooperating with a downregulated p53 axis. A collaborative effect of Csnk1a1 haploinsufficiency and p53 loss on MAPK and Myc upregulation was confirmed on the protein level. Downregulation of Myc protein expression correlated with efficient elimination of blasts in A51 treatment. The "Myc signature" closely resembled the transcriptional profile of patients with del(5q) MDS with TP53 mutation.

CACNA1E
Also flagged:psychiatric illnessbipolar disorder type-Igene expressiontetrahydrocannabinolcannabidiolcell adhesion
Journal Article 2024-02-01 ✓ 3 Snippets Delgado-Sequera A, Garcia-Mompo C, Gonzalez-Pinto A, Hidalgo-Figueroa M, Berrocoso E.
In-Text Gene Mentions

…as CACNA1G ,CACNA1E, CACNB1 ,…

…A shift inCACNA1Eexpression was observed…

…the CACNA1G andCACNA1Ecalcium channel subunits…

Show Full Abstract

<h4>Background</h4>Cannabis use is a risk factor of psychiatric illness, such as bipolar disorder type-I (BDI). Indeed, cannabis use strongly influences the onset and clinical course of BDI, although the biological mechanisms underlying this interaction remain unknown. Therefore, we have reviewed the biological mechanisms affected by cannabis use that may trigger BD.<h4>Methods</h4>A systematic review was carried out of articles in which gene expression was studied in cannabis users or human-derived cells exposed to tetrahydrocannabinol (THC) or cannabidiol (CBD). A second systematic review was then performed to identify articles in which gene expression was studied in BDI samples, highlighting those that described alterations to the same molecular and cellular mechanisms affected by cannabis/THC/CBD.<h4>Results</h4>The initial search identified 82 studies on cannabis and 962 on BDI. After removing duplicates and applying the inclusion/exclusion criteria, 9 studies into cannabis and 228 on BDI were retained. The molecular and cellular mechanisms altered by cannabis use or THC/CBD exposure were then identified, including neural development and function, cytoskeletal function, cell adhesion, mitochondrial biology, inflammatory related pathways, lipid metabolism, the endocannabinoid system, the hypocretin/orexin system, and apoptosis. Alterations to those activities were also described in 19 of 228 focused on BDI.<h4>Conclusions</h4>The biological mechanisms described in this study may be good candidates to the search for diagnostic biomarkers and therapeutic targets for BDI. Because cannabis use can trigger the onset of BD, further studies would be of interest to determine whether they are involved in the early development of the disorder, prompting early treatment.

PEBP1
Also flagged:metabolismribosomal proteinstranslation initiation factorsglucosenucleotides4-thiouracil
Journal Article 2024-02-01 ✓ 4 Snippets Tan TCJ, Spanos C, Tollervey D.
In-Text Gene Mentions

…RAF/MEK complex inhibitor,PEBP1, showed significantly increas…

…activity by thePEBP1/MEK/JNK/JUN axis potentially …

…RAF/MEK complex inhibitorPEBP1, the last one…

…upstream signaling inhibitorPEBP1, this suggests a…

Show Full Abstract

The RNA-interacting proteome is commonly characterized by UV-crosslinking followed by RNA purification, with protein recovery quantified using SILAC labeling followed by data-dependent acquisition (DDA) of proteomic data. However, the low efficiency of UV-crosslinking, combined with limited sensitivity of the DDA approach often restricts detection to relatively abundant proteins, necessitating multiple mass spec injections of fractionated peptides for each biological sample. Here we report an application of data-independent acquisition (DIA) with SILAC in a total RNA-associated protein purification (TRAPP) UV-crosslinking experiment. This gave 15% greater protein detection and lower inter-replicate variation relative to the same biological materials analyzed using DDA, while allowing single-shot analysis of the sample. As proof of concept, we determined the effects of arsenite treatment on the RNA-bound proteome of HEK293T cells. The DIA dataset yielded similar GO term enrichment for RNA-binding proteins involved in cellular stress responses to the DDA dataset while detecting extra proteins unseen by DDA. Overall, the DIA SILAC approach improved detection of proteins over conventional DDA SILAC for generating RNA-interactome datasets, at a lower cost due to reduced machine time. Analyses are described for TRAPP data, but the approach is suitable for proteomic analyses following essentially any RNA-binding protein enrichment technique.

Also flagged:organizationdeathSudden cardiac deathsudden arrhythmic death syndromearrhythmogenic cardiomyopathyidiopathic left ventricular fibrosis
Journal Article 2024-02-01 No Snippets Finocchiaro G, Radaelli D, Johnson D, Bhatia RT, Westaby J, D'Errico S, Papadakis M, Sharma S, Sheppard MN, Behr ER.
Show Full Abstract

<h4>Aims</h4>Sudden cardiac death (SCD) may occur in apparently healthy individuals, including athletes. The aim was to investigate the diagnostic role of post-mortem genetic testing, molecular autopsy (MA), in elucidating the cause of SCD in athletes.<h4>Methods and results</h4>We reviewed a database of 6860 consecutive cases of SCD referred to our specialist cardiac pathology centre. All cases underwent detailed cardiac autopsy, and 748 were deemed to be athletes. Of these, 42 (6%) were investigated with MA (28 using a targeted sequencing, 14 exome sequencing). Variants were classified as pathogenic, likely pathogenic, or variant of unknown significance using international guidelines. Clinical information was obtained from referring coroners who completed a detailed health questionnaire. Out of the 42 decedents (average age 35 years old, 98% males) who were investigated with MA, the autopsy was in keeping with a structurally normal heart [sudden arrhythmic death syndrome (SADS)] in n = 33 (78%) cases, followed by arrhythmogenic cardiomyopathy (ACM) in eight (19%) individuals and idiopathic left ventricular fibrosis in one (2%). Death occurred during exercise and at rest in 26 (62%) and 16 (38%) individuals, respectively. Variants that were adjudicated clinically actionable were present in seven cases (17%). There was concordance between the genetic and phenotypic findings in two cases of ACM (in FLNC and TMEM43 genes). None of the variants identified in SADS cases were previously linked to channelopathies. Clinically actionable variants in cardiomyopathy-associated genes were found in five cases of SADS.<h4>Conclusion</h4>The yield of MA in athletes who died suddenly is 17%. In SADS cases, clinically actionable variants were found in cardiomyopathy-associated genes and not in channelopathy-associated genes. Arrhythmogenic cardiomyopathy is a common cause of SCD in athletes, and one in four decedents with this condition had a clinically actionable variant in FLNC and TMEM43 genes.

Also flagged:autophagyNAFLDchronic liver diseasepathogenesisorganelleslipophagy
Journal Article 2024-02-01 No Snippets Jin S, Li Y, Xia T, Liu Y, Zhang S, Hu H, Chang Q, Yan M.
Show Full Abstract

<h4>Background</h4>Nonalcoholic fatty liver disease (NAFLD) has become the most common chronic liver disease worldwide, whereas there is no approved drug therapy due to its complexity. Studies are emerging to discuss the role of selective autophagy in the pathogenesis of NAFLD, because the specificity among the features of selective autophagy makes it a crucial process in mitigating hepatocyte damage caused by aberrant accumulation of dysfunctional organelles, for which no other pathway can compensate.<h4>Aim of review</h4>This review aims to summarize the types, functions, and dynamics of selective autophagy that are of particular importance in the initiation and progression of NAFLD. And on this basis, the review outlines the therapeutic strategies against NAFLD, in particular the medications and potential natural products that can modulate selective autophagy in the pathogenesis of this disease.<h4>Key scientific concepts of review</h4>The critical roles of lipophagy and mitophagy in the pathogenesis of NAFLD are well established, while reticulophagy and pexophagy are still being identified in this disease due to the insufficient understanding of their molecular details. As gradual blockage of autophagic flux reveals the complexity of NAFLD, studies unraveling the underlying mechanisms have made it possible to successfully treat NAFLD with multiple pharmacological compounds that target associated pathways. Overall, it is convinced that the continued research into selective autophagy occurring in NAFLD will further enhance the understanding of the pathogenesis and uncover novel therapeutic targets.

HFE
Also flagged:hyperferritinemiaironSLC40A1ferroportin diseasedivalent metal transporter 1iron regulatory hormone
Journal Article 2024-02-01 ✓ 1 Snippet Ishikawa T, Tatsumi Y, Kato K, Hayashi Y, Imai N, Ito T, Ishizu Y, Ishigami M, Nihei W, Kato A, Hayashi H.
In-Text Gene Mentions

…entities of non- C282Y-HFE- HC, which shows…

Show Full Abstract

A 59-year-old Japanese woman presented with hyperferritinemia. We decided against iron removal treatment because there were no symptoms or signs of iron-induced organ damage. A follow-up study revealed a gradual increase in transferrin saturation. The patient underwent a second examination at 66 years old. A liver biopsy showed substantial iron deposits in hepatocytes and Kupffer cells but no inflammation or fibrosis. Serum hepcidin-25 levels were highly parallel with hyperferritinemia. A genetic analysis revealed a G80S mutation in SLC40A1. These features are compatible with those of ferroportin disease. The patient remained asymptomatic at 70 years old, suggesting that the iron-loading condition may have been benign.

DCC
Also flagged:Immune-mediated inflammatory diseasesrheumatoid arthritisRAspondyloarthritisconnective tissue disorderscutaneous inflammatory conditions
Journal Article 2024-02-01 ✓ 2 Snippets Yoon C, Ham YS, Gil WJ, Yang CS.
In-Text Gene Mentions

This study showed that DCC, Smad3, Smad4, hMLH1, hMSH2, and hMSH3, which are involved in the colorectal cancer pathway, were regulated by T. gondii infection.

…study showed thatDCC, Smad3, Smad4, hMLH1,…

Show Full Abstract

Immune-mediated inflammatory diseases are various groups of conditions that result in immune system disorders and increased cancer risk. Despite the identification of causative cytokines and pathways, current clinical treatment for immune-mediated inflammatory diseases is limited. In addition, immune-mediated inflammatory disease treatment can increase the risk of cancer. Several previous studies have demonstrated that Toxoplasma gondii manipulates the immune response by inhibiting or stimulating cytokines, suggesting the potential for controlling and maintaining a balanced immune system. Additionally, T. gondii also has the unique characteristic of being a so-called "Trojan horse" bacterium that can be used as a drug delivery system to treat regions that have been resistant to previous drug delivery therapies. In this study, we reviewed the potential of T. gondii in drug development and as a delivery system through current research on inflammation-regulating mechanisms in immune-mediated inflammatory diseases.

SOX6
Also flagged:Cronkhite‒Canada syndromegastrointestinalGIpolyposisanorexiaalopecia
Journal Article 2024-02-01 ✓ 3 Snippets Liu S, Zhi Y, Zhang R, You Y, You W, Xu Q, Li J, Li J.
In-Text Gene Mentions

Lamina propria, SOX6, inflammation and tumor-associated fibroblasts were upregulated, while RSPO3 + fibroblasts were downregulated, and myofibroblasts maintained the same level as control samples (Fig. 6D).

…Lamina propria,SOX6, inflammation and tumor-assoc…

…Lamina propria,SOX6, inflammation and tumor-associated fibroblasts were upregulated, while RSPO3 + fibroblasts were downregulated, and myofibroblasts maintained the same level as control samples (Fig. 6 D).…

Show Full Abstract

<h4>Background</h4>Cronkhite-Canada syndrome (CCS) is a rare, nonhereditary disease characterized by diffuse gastrointestinal polyposis and ectodermal abnormalities. Although it has been proposed to be a chronic inflammatory condition, direct evidence of its pathogenesis is lacking. This study aims to investigate the pathophysiology of CCS by analyzing transcriptomic changes in the colonic microenvironment.<h4>Methods</h4>Next-generation sequencing-based genome-wide transcriptional profiling was performed on colonic hamartomatous polyps from four CCS patients and normal colonic mucosa from four healthy volunteers. Analyses of differential expression and multiple enrichment analyses were conducted from the molecular level to the cellular level. Quantitative real-time PCR (qRT-PCR) was carried out to validate the sequencing accuracy in samples from six CCS patients and six healthy volunteers.<h4>Results</h4>A total of 543 differentially expressed genes were identified, including an abundance of CC- and CXC-chemokines. Innate immune response-related pathways and processes, such as leukocyte chemotaxis, cytokine production, IL-17, TNF, IL-1 and NF-kB signaling pathways, were prominently enhanced in CCS colonic polyps. Upregulation of wound healing, epithelial-mesenchymal transition, Wnt, and PI3K-Akt signaling pathways were also observed. Enrichment analyses at different levels identified extracellular structure disorganization, dysfunction of the gut mucosal barrier, and increased angiogenesis. Validation by qRT-PCR confirmed increased expression of the LCN2, IL1B, CXCL1, and CXCL3 genes in CCS colonic polyps.<h4>Conclusions</h4>This case-control whole transcriptome analysis of active CCS colonic hamartomatous polyps revealed intricate molecular pathways, emphasizing the role of the innate immune response, extracellular matrix disorganization, inflammatory cell infiltration, increased angiogenesis, and potential epithelial to mesenchymal transition. These findings supports CCS as a chronic inflammatory condition and sheds light on potential therapeutic targets, paving the way for more effective and personalized management of CCS in the future.

SUDS3
Also flagged:extracellularYes-associated proteinnucleusmembranechromatinorganization
Journal Article 2024-02-01 ✓ 1 Snippet Mannion AJ, Zhao H, Zhang Y, von Wright Y, Bergman O, Roy J, Saharinen P, Holmgren L.
In-Text Gene Mentions

…of the PRC (polycomb repressiverepressive complex) and…

Show Full Abstract

<h4>Background</h4>Endothelial cells are constantly exposed to mechanical forces in the form of fluid shear stress, extracellular stiffness, and cyclic strain. The mechanoresponsive activity of YAP (Yes-associated protein) and its role in vascular development are well described; however, whether changes to transcription or epigenetic regulation of YAP are involved in these processes remains unanswered. Furthermore, how mechanical forces are transduced to the nucleus to drive transcriptional reprogramming in endothelial cells is poorly understood. The YAP target gene, <i>AmotL2</i> (angiomotin-like 2), is a junctional mechanotransducer that connects cell-cell junctions to the nuclear membrane via the actin cytoskeleton.<h4>Methods</h4>We applied mechanical manipulations including shear flow, stretching, and substrate stiffness to endothelial cells to investigate the role of mechanical forces in modulating <i>YAP</i> transcription. Using in vitro and in vivo endothelial depletion of AmotL2, we assess nuclear morphology, chromatin organization (using transposase-accessible chromatin sequencing), and whole-mount immunofluorescent staining of the aorta to determine the regulation and functionality of YAP. Finally, we use genetic and chemical inhibition to uncouple the nuclear-cytoskeletal connection to investigate the role of this pathway on <i>YAP</i> transcription.<h4>Results</h4>Our results reveal that mechanical forces sensed at cell-cell junctions by the YAP target gene <i>AmotL2</i> are directly involved in changes in global chromatin accessibility and activity of the histone methyltransferase EZH2, leading to modulation of <i>YAP</i> promotor activity. Functionally, shear stress-induced proliferation of endothelial cells in vivo was reliant on AmotL2 and YAP/TAZ (transcriptional coactivator with PDZ-binding motif) expression. Mechanistically, uncoupling of the nuclear-cytoskeletal connection from junctions and focal adhesions led to altered nuclear morphology, chromatin accessibility, and <i>YAP</i> promotor activity.<h4>Conclusions</h4>Our findings reveal a role for AmotL2 and nuclear-cytoskeletal force transmission in modulating the epigenetic and transcriptional regulation of YAP to maintain a mechano-enforced positive feedback loop of vascular homeostasis. These findings may offer an explanation as to the proinflammatory phenotype that leads to aneurysm formation observed in AmotL2 endothelial deletion models.

Also flagged:diabetic kidney diseasetype 2 diabetes mellitusC7SERPINA4IGHG1SEMG2
Journal Article 2024-02-01 No Snippets Huang X, Zhang H, Liu J, Yang X, Liu Z.
Show Full Abstract

<h4>Background</h4>There are big differences in treatments and prognosis between diabetic kidney disease (DKD) and non-diabetic renal disease (NDRD). However, DKD patients couldn't be diagnosed early due to lack of special biomarkers. Urine is an ideal non-invasive sample for screening DKD biomarkers. This study aims to explore DKD special biomarkers by urinary proteomics.<h4>Materials and methods</h4>According to the result of renal biopsy, 142 type 2 diabetes mellitus (T2DM) patients were divided into 2 groups: DKD (n = 83) and NDRD (n = 59). Ten patients were selected from each group to define urinary protein profiles by label-free quantitative proteomics. The candidate proteins were further verifyied by parallel reaction monitoring (PRM) methods (n = 40). Proteins which perform the same trend both in PRM and proteomics were verified by enzyme-linked immunosorbent assays (ELISA) with expanding the sample size (n = 82). The area under the receiver operating characteristic curve (AUC) was used to evaluate the accuracy of diagnostic biomarkers.<h4>Results</h4>We identified 417 peptides in urinary proteins showing significant difference between DKD and NDRD. PRM verification identified C7, SERPINA4, IGHG1, SEMG2, PGLS, GGT1, CDH2, CDH1 was consistent with the proteomic results and p < 0.05. Three potential biomarkers for DKD, C7, SERPINA4, and gGT1, were verified by ELISA. The combinatied SERPINA4/Ucr and gGT1/Ucr (AUC = 0.758, p = 0.001) displayed higher diagnostic efficiency than C7/Ucr (AUC = 0.632, p = 0.048), SERPINA4/Ucr (AUC = 0.661, p = 0.032), and gGT1/Ucr (AUC = 0.661, p = 0.029) respectively.<h4>Conclusions</h4>The combined index SERPINA4/Ucr and gGT1/Ucr can be considered as candidate biomarkers for diabetic nephropathy after adjusting by urine creatinine.

HFE
Also flagged:CD4VEGFMETRNA polymerase IIAIDSnucleotides
Journal Article 2024-02-01 ✓ 1 Snippet Kroeze S, Kootstra NA, van Nuenen AC, Rossouw TM, Kityo CM, Siwale M, Akanmu S, Mandaliya K, de Jager M, Ondoa P, Wit FW, Reiss P, Rinke de Wit TF, Hamers RL.
In-Text Gene Mentions

…and SP1 ,HFE, PAIMP1 were…

Show Full Abstract

<h4>Objective</h4>This study investigated the association of plasma microRNAs before and during antiretroviral therapy (ART) with poor CD4 + T-cell recovery during the first year of ART.<h4>Design</h4>MicroRNAs were retrospectively measured in stored plasma samples from people with HIV (PWH) in sub-Saharan Africa who were enrolled in a longitudinal multicountry cohort and who had plasma viral-load less than 50 copies/ml after 12 months of ART.<h4>Methods</h4>First, the levels of 179 microRNAs were screened in a subset of participants from the lowest and highest tertiles of CD4 + T-cell recovery (ΔCD4) ( N  = 12 each). Next, 11 discordant microRNAs, were validated in 113 participants (lowest tertile ΔCD4: n  = 61, highest tertile ΔCD4: n  = 52). For discordant microRNAs in the validation, a pathway analysis was conducted. Lastly, we compared microRNA levels of PWH to HIV-negative controls.<h4>Results</h4>Poor CD4 + T-cell recovery was associated with higher levels of hsa-miR-199a-3p and hsa-miR-200c-3p before ART, and of hsa-miR-17-5p and hsa-miR-501-3p during ART. Signaling by VEGF and MET, and RNA polymerase II transcription pathways were identified as possible targets of hsa-miR-199a-3p, hsa-200c-3p, and hsa-miR-17-5p. Compared with HIV-negative controls, we observed lower hsa-miR-326, hsa-miR-497-5p, and hsa-miR-501-3p levels before and during ART in all PWH, and higher hsa-miR-199a-3p and hsa-miR-200c-3p levels before ART in all PWH, and during ART in PWH with poor CD4 + T-cell recovery only.<h4>Conclusion</h4>These findings add to the understanding of pathways involved in persistent HIV-induced immune dysregulation during suppressive ART.

DCC
Also flagged:NTN1RAD51DNAL4
Journal Article 2024-02-01 ✓ 1 Snippet Ozyavuz Cubuk P.
In-Text Gene Mentions

…mutations in theDCC, NTN1, RAD51, and…

Show Full Abstract

The 9p deletion syndrome, which was defined in a detailed way in the previous studies, was characterized by various clinical features such as psychomotor retardation, dysmorphic features and genital anomalies. In contrast to 9p deletion syndrome, 20p duplication was rarely reported in the literature with only a few case reports. Regarding the combination of 9p deletion syndrome and 20p duplication, we found that it was reported in only four patients. In the current study, we aimed to investigate a rare chromosomal rearrangement, partial monosomy 9p and trisomy 20p which was observed in two patients with mirror hand movements. The mirror hand movements was influenced by the combination of genetic and environmental factors. While some cases have been associated with mutations in the DCC, NTN1, RAD51, and DNAL4, there were many cases where the genetic basis of mirror hand movements remained unexplained. There was no alteration detected in genes that were previously known as a cause of mirror hand movement in our patients. This new finding could potentially be attributed to the dosage effect of genes within the 9p deletion or 20p duplication regions or to the genes disrupted within the breakpoint region. Future research focusing on the genes within this genomic locus may hold the potential to uncover novel etiologic reasons for mirror hand movements.

PRDX6
Also flagged:biomacromoleculesglycolic acidperoxidaseHRPbiotinphenol
Journal Article 2024-02-01 ✓ 1 Snippet Ren J, Zhang Z, Geng S, Cheng Y, Han H, Fan Z, Dai W, Zhang H, Wang X, Zhang Q, He B.
In-Text Gene Mentions

…(PPT1), and peroxiredoxin-6 (PRDX6), also gradually accumulate…

Show Full Abstract

Achieving increasingly finely targeted drug delivery to organs, tissues, cells, and even to intracellular biomacromolecules is one of the core goals of nanomedicines. As the delivery destination is refined to cellular and subcellular targets, it is essential to explore the delivery of nanomedicines at the molecular level. However, due to the lack of technical methods, the molecular mechanism of the intracellular delivery of nanomedicines remains unclear to date. Here, we develop an enzyme-induced proximity labeling technology in nanoparticles (nano-EPL) for the real-time monitoring of proteins that interact with intracellular nanomedicines. Poly(lactic-co-glycolic acid) nanoparticles coupled with horseradish peroxidase (HRP) were fabricated as a model (HRP(+)-PNPs) to evaluate the molecular mechanism of nano delivery in macrophages. By adding the labeling probe biotin-phenol and the catalytic substrate H<sub>2</sub>O<sub>2</sub> at different time points in cellular delivery, nano-EPL technology was validated for the real-time in situ labeling of proteins interacting with nanoparticles. Nano-EPL achieves the dynamic molecular profiling of 740 proteins to map the intracellular delivery of HRP (+)-PNPs in macrophages over time. Based on dynamic clustering analysis of these proteins, we further discovered that different organelles, including endosomes, lysosomes, the endoplasmic reticulum, and the Golgi apparatus, are involved in delivery with distinct participation timelines. More importantly, the engagement of these organelles differentially affects the drug delivery efficiency, reflecting the spatial-temporal heterogeneity of nano delivery in cells. In summary, these findings highlight a significant methodological advance toward understanding the molecular mechanisms involved in the intracellular delivery of nanomedicines.

OLFM4
Also flagged:Gene ExpressionRheumatoid ArthritisRAInterstitial Lung Diseasearginase 1ARG1
Journal Article 2024-02-01 ✓ 1 Snippet Wierczeiko A, Linke M, Friedrich JP, Koch J, Schwarting A, Krause A, Gerber S, Gerber A.
In-Text Gene Mentions

…>), <i>olfactomedin 4</i> (<i>OLFM4), baculoviral inhibitor of…

Show Full Abstract

<h4>Objective</h4>Rheumatoid arthritis (RA)-associated interstitial lung disease (ILD) is one of the most common and prognostic organ manifestations of RA. Therefore, to allow effective treatment, it is of crucial importance to diagnose RA-ILD at the earliest possible stage. So far, the gold standard of early detection has been high-resolution computed tomography (HRCT) of the lungs. This procedure involves considerable radiation exposure for the patient and is therefore unsuitable as a routine screening measure for ethical reasons. Here, we propose the analysis of characteristic gene expression patterns as a biomarker to aid in the early detection and initiation of appropriate, possibly antifibrotic, therapy.<h4>Methods</h4>To investigate unique molecular patterns of RA-ILD, whole blood samples were taken from 12 female patients with RA-ILD (n = 7) or RA (n = 5). The RNA was extracted, sequenced by RNA-Seq, and analyzed for characteristic differences in the gene expression patterns between patients with RA-ILD and those with RA without ILD.<h4>Results</h4>The differential gene expression analysis revealed 9 significantly upregulated genes in RA-ILD compared to RA without ILD: <i>arginase 1</i> (<i>ARG1</i>), <i>thymidylate synthetase</i> (<i>TYMS</i>), <i>sortilin 1</i> (<i>SORT1</i>), <i>marker of proliferation Ki-67</i> (<i>MKI67</i>), <i>olfactomedin 4</i> (<i>OLFM4), baculoviral inhibitor of apoptosis repeat containing 5</i> (<i>BIRC5</i>), <i>membrane spanning 4-domains A4A</i> (<i>MS4A4A</i>), <i>C-type lectin domain family 12 member A</i> (<i>CLEC12A</i>), and the <i>long intergenic nonprotein coding RNA</i> (<i>LINC02967</i>).<h4>Conclusion</h4>All gene products of these genes (except for <i>LINC02967</i>) are known from the literature to be involved in the pathogenesis of fibrosis. Further, for some, a contribution to the development of pulmonary fibrosis has even been demonstrated in experimental studies. Therefore, the results presented here provide an encouraging perspective for using specific gene expression patterns as biomarkers for the early detection and differential diagnosis of RA-ILD as a routine screening test.

MLLT10
Also flagged:FSTL3tumorPD1Programmed cell death 1 ligand 1PDL1programmed cell death 1
Journal Article 2024-02-01 ✓ 1 Snippet Li H, Zheng N, Guo A, Tang W, Li M, Cao Y, Ma X, Cao H, Ma Y, Wang H, Zhao S.
In-Text Gene Mentions

…through interaction withMLLT10[ 40 ].…

Show Full Abstract

Programmed cell death 1 ligand 1 (PDL1)/programmed cell death 1 (PD1) blockade immunotherapy provides a prospective strategy for the treatment of colorectal cancer (CRC), but various constraints on the effectiveness of the treatment are still remaining. As reported in previous studies, follistatin-like 3 (FSTL3) could mediate inflammatory response in macrophages by induction lipid accumulation. Herein, we revealed that FSTL3 were overexpressed in malignant cells in the CRC microenvironment, notably, the expression level of FSTL3 was related to tumor immune evasion and the clinical efficacy of anti-PD1 therapy. Further studies determined that hypoxic tumor microenvironment induced the FSTL3 expression via HIF1α in CRC cells, FSTL3 could bind to the transcription factor c-Myc (354-406 amino acids) to suppress the latter's ubiquitination and increase its stability, thereby to up-regulated the expression of PDL1 and indoleamine 2,3-dioxygenase 1 (IDO1). The results in the immunocompetent tumor models verified that FSLT3 knockout in tumor cells increased the proportion of CD8<sup>+</sup> T cells in the tumor microenvironment, reduced the proportion of regulatory T cells (CD25<sup>+</sup> Foxp3<sup>+</sup>) and exhausted T cells (PD1<sup>+</sup> CD8<sup>+</sup>), and synergistically improved the anti-PD1 therapy efficacy. To sum up, FSTL3 enhanced c-Myc-mediated transcriptional regulation to promote immune evasion and attenuates response to anti-PD1 therapy in CRC, suggesting the potential of FSTL3 as a biomarker of immunotherapeutic efficacy as well as a novel immunotherapeutic target in CRC.

DCC
Also flagged:synaptic cleftcytoplasmsynapsesynapsestransportersmembrane
Journal Article 2024-02-01 ✓ 2 Snippets Dewa KI, Arimura N, Kakegawa W, Itoh M, Adachi T, Miyashita S, Inoue YU, Hizawa K, Hori K, Honjoya N, Yagishita H, Taya S, Miyazaki T, Usui C, Tatsumoto S, Tsuzuki A, Uetake H, Sakai K, Yamakawa K, Sasaki T, Nagai J, Kawaguchi Y, Sone M, Inoue T, Go Y, Ichinohe N, Kaibuchi K, Watanabe M, Koizumi S, Yuzaki M, Hoshino M.
In-Text Gene Mentions

…in colorectal cancer (DCC), with DSCAM mediates…

…omophilic binding or Netrin-1/DCCbinding; these studies…

Show Full Abstract

In the central nervous system, astrocytes enable appropriate synapse function through glutamate clearance from the synaptic cleft; however, it remains unclear how astrocytic glutamate transporters function at peri-synaptic contact. Here, we report that Down syndrome cell adhesion molecule (DSCAM) in Purkinje cells controls synapse formation and function in the developing cerebellum. Dscam-mutant mice show defects in CF synapse translocation as is observed in loss of function mutations in the astrocytic glutamate transporter GLAST expressed in Bergmann glia. These mice show impaired glutamate clearance and the delocalization of GLAST away from the cleft of parallel fibre (PF) synapse. GLAST complexes with the extracellular domain of DSCAM. Riluzole, as an activator of GLAST-mediated uptake, rescues the proximal impairment in CF synapse formation in Purkinje cell-selective Dscam-deficient mice. DSCAM is required for motor learning, but not gross motor coordination. In conclusion, the intercellular association of synaptic and astrocyte proteins is important for synapse formation and function in neural transmission.

SOX6
Also flagged:retinoic acidBMPOsteoarthritisjoint conditiondegradationretinoic acid receptors
Journal Article 2024-02-01 ✓ 2 Snippets Mancini FE, Humphreys PEA, Woods S, Bates N, Cuvertino S, O'Flaherty J, Biant L, Domingos MAN, Kimber SJ.
In-Text Gene Mentions

…as SOX5 ,SOX6, SOX9 and…

…genes SOX9, SOX5,SOX619 .…

Show Full Abstract

Osteoarthritis is the most common degenerative joint condition, leading to articular cartilage (AC) degradation, chronic pain and immobility. The lack of appropriate therapies that provide tissue restoration combined with the limited lifespan of joint-replacement implants indicate the need for alternative AC regeneration strategies. Differentiation of human pluripotent stem cells (hPSCs) into AC progenitors may provide a long-term regenerative solution but is still limited due to the continued reliance upon growth factors to recapitulate developmental signalling processes. Recently, TTNPB, a small molecule activator of retinoic acid receptors (RARs), has been shown to be sufficient to guide mesodermal specification and early chondrogenesis of hPSCs. Here, we modified our previous differentiation protocol, by supplementing cells with TTNPB and administering BMP2 at specific times to enhance early development (referred to as the RAPID-E protocol). Transcriptomic analyses indicated that activation of RAR signalling significantly upregulated genes related to limb and embryonic skeletal development in the early stages of the protocol and upregulated genes related to AC development in later stages. Chondroprogenitors obtained from RAPID-E could generate cartilaginous pellets that expressed AC-related matrix proteins such as Lubricin, Aggrecan, and Collagen II, but additionally expressed Collagen X, indicative of hypertrophy. This protocol could lay the foundations for cell therapy strategies for osteoarthritis and improve the understanding of AC development in humans.

DCC
Also flagged:dysplasia of the corpus callosumpartial agenesis of the corpus callosumCCcorpus callosum dysplasianeurodevelopmental disordersACC
Journal Article 2024-02-01 ✓ 5 Snippets Huang R, Chen J, Hou X, Liu L, Sun G, Pan H, Ma Y.
In-Text Gene Mentions

…nonisolated PACC andDCC, 19 cases were…

…with PACC andDCCand analyzed the…

…cases of isolatedDCCand 6 cases…

…cases of nonisolatedDCC.…

…CC classified asDCC[ 7 ].…

Show Full Abstract

<h4>Background</h4>To analyze the genetic characteristics and long-term outcomes of fetuses with dysplasia of the corpus callosum (DCC) or partial agenesis of the corpus callosum (PACC).<h4>Methods</h4>A total of 42 fetuses with DCC (n = 36) or PACC (n = 6) were retrospectively analyzed from January 2016 to December 2022 at the Peking University First Hospital. The cohort was categorized into isolated (15/42, 36%) and nonisolated groups (27/42, 64%), and differences in the genetic abnormalities and long-term outcomes between the two groups were analyzed. DCC was subdivided into short CC, thin CC, and thick CC. The outcomes of the three different types of DCC were analyzed and discussed.<h4>Results</h4>(1) Thirty-nine of the 42 cases underwent CMA (chromosomal microarray analysis) and CMA + WES (whole exome sequencing), with 13/15 cases in isolated group and 26/27 cases in nonisolated group. Only pathogenic or likely pathogenic (P/LP) variants were considered, identifying P/LP variants in 2/13 cases in isolated group and 12/26 cases in nonisolated group. There was no significant difference between the two groups (χ² = 3.566, P = 0.05897). (2) In the isolated group, 8 cases were terminated, and 7 cases were delivered. Postnatal follow-up detected 1 case of gross motor development delay one year after birth; no obvious abnormalities were found in the other six cases. In the nonisolated group, 21 cases were terminated, and 6 cases were delivered. Postnatal follow-up detected 4 cases of children with different degrees of language, motor and intelligence abnormalities; 1 case died 10 days after birth. No obvious abnormalities were observed in one case. Six cases (86%, 6/7) in the isolated group showed normal development, compared with 1 case (17%, 1/6) in the nonisolated group, with a significant difference (χ² = 6.198, P = 0.01279). (3) In DCC, the delivery rates of short CCs (18 cases), thin CCs (13 cases), and thick CCs (5 cases) were 17% (3/18), 54% (7/13), and 20% (1/5), respectively, with good outcomes observed in 0% (0/3), 71% (5/7), and 0% (0/1), respectively. P/LP variants were found in 6/17 cases of short CC, 3/12 cases of thin CC, and 2/5 cases of thick CC.<h4>Conclusions</h4>Fetuses with DCC or PACC combined with other structural abnormalities had a poor long-term prognosis compared with the isolated group. Patients with thin CCs had a higher probability of a good prognosis than those with short or thick CCs.

Also flagged:gene expressionmethylationcancerlung cancerbreast cancercell differentiation
Journal Article 2024-02-01 No Snippets Xie K, Hou Y, Zhou X.
Show Full Abstract

<h4>Motivation</h4>Classification of samples using biomedical omics data is a widely used method in biomedical research. However, these datasets often possess challenging characteristics, including high dimensionality, limited sample sizes, and inherent biases across diverse sources. These factors limit the performance of traditional machine learning models, particularly when applied to independent datasets.<h4>Results</h4>To address these challenges, we propose a novel classifier, Deep Centroid, which combines the stability of the nearest centroid classifier and the strong fitting ability of the deep cascade strategy. Deep Centroid is an ensemble learning method with a multi-layer cascade structure, consisting of feature scanning and cascade learning stages that can dynamically adjust the training scale. We apply Deep Centroid to three precision medicine applications-cancer early diagnosis, cancer prognosis, and drug sensitivity prediction-using cell-free DNA fragmentations, gene expression profiles, and DNA methylation data. Experimental results demonstrate that Deep Centroid outperforms six traditional machine learning models in all three applications, showcasing its potential in biological omics data classification. Furthermore, functional annotations reveal that the features scanned by the model exhibit biological significance, indicating its interpretability from a biological perspective. Our findings underscore the promising application of Deep Centroid in the classification of biomedical omics data, particularly in the field of precision medicine.<h4>Availability and implementation</h4>Deep Centroid is available at both github (github.com/xiexiexiekuan/DeepCentroid) and Figshare (https://figshare.com/articles/software/Deep_Centroid_A_General_Deep_Cascade_Classifier_for_Biomedical_Omics_Data_Classification/24993516).

TNFSF4
Also flagged:bladder urothelial cancertumorBLCAbladder cancerGene ExpressionRBPMS
Journal Article 2024-02-01 ✓ 1 Snippet Dong Y, Wu X, Xu C, Hameed Y, Abdel-Maksoud MA, Almanaa TN, Kotob MH, Al-Qahtani WH, Mahmoud AM, Cho WC, Li C.
In-Text Gene Mentions

…checkpoint blockade, includingTNFSF4, PDCD1LG2, LAIR1, CTLA4,…

Show Full Abstract

<h4>Background</h4>Mounting studies indicate that oxidative stress (OS) significantly contributes to tumor progression. Our study focused on bladder urothelial cancer (BLCA), an escalating malignancy worldwide that is growing rapidly. Our objective was to verify the predictive precision of genes associated with overall survival (OS) by constructing a model that forecasts outcomes for bladder cancer and evaluates the prognostic importance of these genetic markers.<h4>Methods</h4>Transcriptomic data were obtained from TCGA-BLCA and GSE31684, which are components of the Cancer Genome Atlas (TCGA) and Gene Expression Omnibus (GEO), respectively. To delineate distinct molecular subtypes, we employed the non-negative matrix factorization (NMF)method. The significance of OS-associated genes in predicting outcomes was assessed using lasso regression, multivariate Cox analysis, and univariate Cox regression analysis. For external validation, we employed the GSE31684 dataset. CIBERSORT was utilized to examine the tumor immune microenvironment (TIME). A nomogram was created and verified using calibration and receiver operating characteristic (ROC) curves, which are based on risk signatures. We examined variations in clinical characteristics and tumor mutational burden (TMB) among groups classified as high-risk and low-risk. To evaluate the potential of immunotherapy, the immune phenomenon score (IPS) was computed based on the risk score. In the end, the pRRophetic algorithm was employed to forecast the IC50 values of chemotherapy medications.<h4>Results</h4>In our research, we examined the expression of 275 genes associated with OS in 19 healthy and 414 cancerous tissues of the bladder obtained from the TCGA database. As a result, a new risk signature was created that includes 4 genes associated with OS (RBPMS, CRYAB, P4HB, and PDGFRA). We found two separate groups, C1 and C2, that showed notable variations in immune cells and stromal score. According to the Kaplan-Meier analysis, patients classified as high-risk experienced a considerably reduced overall survival in comparison to those categorized as low-risk (P<0.001). The predictive capability of the model was indicated by the area under the curve (AUC) of the receiver operating characteristic (ROC) curve surpassing 0.6. Our model showed consistent distribution of samples from both the GEO database and TCGA data. Both the univariate and multivariate Cox regression analyses validated the importance of the risk score in relation to overall survival (P < 0.001). According to our research, patients with a lower risk profile may experience greater advantages from using a CTLA4 inhibitor, whereas patients with a higher risk profile demonstrated a higher level of responsiveness to Paclitaxel and Cisplatin. In addition, methotrexate exhibited a more positive outcome in patients with low risk compared to those with high risk.<h4>Conclusions</h4>Our research introduces a novel model associated with OS gene signature in bladder cancer, which uncovers unique survival results. This model can assist in tailoring personalized treatment approaches and enhancing patient therapeutic effect in the management of bladder cancer.

Also flagged:vitamin Avitamin B12vitamin B9zincironpectin
Journal Article 2024-02-01 No Snippets Holani R, Littlejohn PT, Edwards K, Petersen C, Moon KM, Stacey RG, Bozorgmehr T, Gerbec ZJ, Serapio-Palacios A, Krekhno Z, Donald K, Foster LJ, Turvey SE, Finlay BB.
Show Full Abstract

<h4>Background & aims</h4>Micronutrient deficiency (MND) (ie, lack of vitamins and minerals) during pregnancy is a major public health concern. Historically, studies have considered micronutrients in isolation; however, MNDs rarely occur alone. The impact of co-occurring MNDs on public health, mainly in shaping mucosal colonization by pathobionts from the Enterobacteriaceae family, remains undetermined due to lack of relevant animal models.<h4>Methods</h4>To establish a maternal murine model of multiple MND (MMND), we customized a diet deficient in vitamins (A, B12, and B9) and minerals (iron and zinc) that most commonly affect children and women of reproductive age. Thereafter, mucosal adherence by Enterobacteriaceae, the associated inflammatory markers, and proteomic profile of intestines were determined in the offspring of MMND mothers (hereafter, low micronutrient [LM] pups) via bacterial plating, flow cytometry, and mass spectrometry, respectively. For human validation, Enterobacteriaceae abundance, assessed via 16s sequencing of 3-month-old infant fecal samples (n = 100), was correlated with micronutrient metabolites using Spearman's correlation in meconium of children from the CHILD birth cohort.<h4>Results</h4>We developed an MMND model and reported an increase in colonic abundance of Enterobacteriaceae in LM pups at weaning. Findings from CHILD cohort confirmed a negative correlation between Enterobacteriaceae and micronutrient availability. Furthermore, pro-inflammatory cytokines and increased infiltration of lymphocyte antigen 6 complex high monocytes and M1-like macrophages were evident in the colons of LM pups. Mechanistically, mitochondrial dysfunction marked by reduced expression of nicotinamide adenine dinucleotide (NAD)H dehydrogenase and increased expression of NAD phosphate oxidase (Nox) 1 contributed to the Enterobacteriaceae bloom.<h4>Conclusion</h4>This study establishes an early life MMND link to intestinal pathobiont colonization and mucosal inflammation via damaged mitochondria in the offspring.

ABT1
Also flagged:Receptors ActivityRibbon SynapsesGlutamateCx30GJB6Hearing
Journal Article 2024-02-01 ✓ 1 Snippet Unknown Authors
In-Text Gene Mentions

Abt1

Show Full Abstract

No abstract available.

Also flagged:myopiaHigh myopiaeye diseasesretinal dystrophiesretinitis pigmentosaRP
Journal Article 2024-02-01 No Snippets Chen C, An G, Yu X, Wang S, Lin P, Yuan J, Zhuang Y, Lu X, Bai Y, Zhang G, Su J, Qu J, Xu L, Wang H.
Show Full Abstract

<h4>Purpose</h4>This observational study aimed to identify mutations in monogenic syndromic high myopia (msHM) using data from reported samples (n = 9370) of the Myopia Associated Genetics and Intervention Consortium (MAGIC) project.<h4>Methods</h4>The targeted panel containing 298 msHM-related genes was constructed and screening of clinically actionable variants was performed based on whole exome sequencing. Capillary sequencing was used to verify the identified gene mutations in the probands and perform segregation analysis with their relatives.<h4>Results</h4>A total of 381 candidate variants in 84 genes and 85 eye diseases were found to contribute to msHM in 3.6% (335/9370) of patients with HM. Among them, the 22 genes with the most variations accounted for 62.7% of the diagnostic cases. In the genotype-phenotype association analysis, 60% (201/335) of suspected msHM cases were recalled and 25 patients (12.4%) received a definitive genetic diagnosis. Pathogenic variants were distributed in 18 msHM-related diseases, mainly involving retinal dystrophy genes (e.g. TRPM1, CACNA1F, and FZD4), connective tissue disease genes (e.g. FBN1 and COL2A1), corneal or lens development genes (HSF4, GJA8, and MIP), and other genes (TEK). The msHM gene mutation types were allocated to four categories: nonsense mutations (36%), missense mutations (36%), frameshift mutations (20%), and splice site mutations (8%).<h4>Conclusions</h4>This study highlights the importance of thorough molecular subtyping of msHM to provide appropriate genetic counselling and multispecialty care for children and adolescents with HM.

HTT
Also flagged:localizationRNA binding proteinsRBPbindinggene expressioncell differentiation
Journal Article 2024-02-01 ✓ 2 Snippets Wang J, Horlacher M, Cheng L, Winther O.
In-Text Gene Mentions

…results from alteredHTTgene concentration in…

…to reduce mutantHTTmRNA accumulation and…

Show Full Abstract

<h4>Motivation</h4>Accurate prediction of RNA subcellular localization plays an important role in understanding cellular processes and functions. Although post-transcriptional processes are governed by trans-acting RNA binding proteins (RBPs) through interaction with cis-regulatory RNA motifs, current methods do not incorporate RBP-binding information.<h4>Results</h4>In this article, we propose DeepLocRNA, an interpretable deep-learning model that leverages a pre-trained multi-task RBP-binding prediction model to predict the subcellular localization of RNA molecules via fine-tuning. We constructed DeepLocRNA using a comprehensive dataset with variant RNA types and evaluated it on the held-out dataset. Our model achieved state-of-the-art performance in predicting RNA subcellular localization in mRNA and miRNA. It has also demonstrated great generalization capabilities, performing well on both human and mouse RNA. Additionally, a motif analysis was performed to enhance the interpretability of the model, highlighting signal factors that contributed to the predictions. The proposed model provides general and powerful prediction abilities for different RNA types and species, offering valuable insights into the localization patterns of RNA molecules and contributing to our understanding of cellular processes at the molecular level. A user-friendly web server is available at: https://biolib.com/KU/DeepLocRNA/.

Also flagged:hydroxyapatitecancersinflammatory responseimmune responseantigen presentationbromide
Journal Article 2024-02-01 No Snippets Rossi JF, Frayssinet P, Matciyak M, Tupitsyn N.
Show Full Abstract

Immune adjuvants are immune modulators that have been developed in the context of infectious vaccinations. There is currently a growing interest in immune adjuvants due to the development of immunotherapy against cancers. Immune adjuvant mechanisms of action are focused on the initiation and amplification of the inflammatory response leading to the innate immune response, followed by the adaptive immune response. The main activity lies in the support of antigen presentation and the maturation and functions of dendritic cells. Most immune adjuvants are associated with a vaccine or incorporated into the new generation of mRNA vaccines. Few immune adjuvants are used as drugs. Hydroxyapatite (HA) ceramics and azoximer bromide (AZB) are overlooked molecules that were used in early clinical trials, which demonstrated clinical efficacy and excellent tolerance profiles. HA combined in an autologous vaccine was previously developed in the veterinary field for use in canine spontaneous lymphomas. AZB, an original immune modulator derived from a class of heterochain aliphatic polyamines that is licensed in Russia, the Commonwealth of Independent States, and Slovakia for infectious and inflammatory diseases, is and now being developed for use in cancer with promising results. These two immune adjuvants can be combined in various immunotherapy strategies.

OLFM4
Also flagged:autoimmune disorderantiphospholipid syndromeautoimmune thrombophiliaantibodiesvascular thrombosisantibody
Journal Article 2024-02-01 ✓ 2 Snippets López-Pedrera C, Cerdó T, Jury EC, Muñoz-Barrera L, Escudero-Contreras A, Aguirre MA, Pérez-Sánchez C.
In-Text Gene Mentions

Additionally, patients with recurrent thrombosis exhibited significant changes in the expression of several genes (MYOM2, MMP8, CAMP, OLFM4, CRISP3, CEACAM6, CEACAM8, DEFA3, DEFA4, LCN2 and LTF) when compared with those with non-recurrent thrombosis.

…, CAMP ,OLFM4, CRISP3 ,…

Show Full Abstract

APS patients exhibit a wide clinical heterogeneity in terms of the disease's origin and progression. This diversity can be attributed to consistent aPL profiles and other genetic and acquired risk factors. Therefore, understanding the pathophysiology of APS requires the identification of specific molecular signatures that can explain the pro-atherosclerotic, pro-thrombotic and inflammatory states observed in this autoimmune disorder. In recent years, significant progress has been made in uncovering gene profiles and understanding the intricate epigenetic mechanisms and microRNA changes that regulate their expression. These advancements have highlighted the crucial role played by these regulators in influencing various clinical aspects of APS. This review delves into the recent advancements in genomic and epigenetic approaches used to uncover the mechanisms contributing to vascular and obstetric involvement in APS. Furthermore, we discuss the implementation of novel bioinformatics tools that facilitate the investigation of these mechanisms and pave the way for personalized medicine in APS.

POU3F2
Also flagged:TFbindingglioblastomagene expressiontranscription factorsCC
Journal Article 2024-02-01 ✓ 5 Snippets Guo J, Zhang W, Chen X, Yen A, Chen L, Shively CA, Li D, Wang T, Dougherty JD, Mitra RD.
In-Text Gene Mentions

Our reanalysis of published data generated several novel hypotheses, such as the role of Nfia and Zbtb20 binding at the Pou3f2 enhancer in astrocytogenesis, novel binding of Tye7p upon gcr2 knockout, and novel TF families that may be involved in sex difference in GBM that were not identified in the original publications (see Supplementary Notes and Supplementary Table S6).

…the expression ofPou3f2( Medeiros de…

…binding correlates withPou3f2expression (high in…

…activity of thePou3f2enhancer in astrocytes,…

…binding at thePou3f2enhancer in astrocytogenesis,…

Show Full Abstract

<h4>Motivation</h4>Unraveling the transcriptional programs that control how cells divide, differentiate, and respond to their environments requires a precise understanding of transcription factors' (TFs) DNA-binding activities. Calling cards (CC) technology uses transposons to capture transient TF binding events at one instant in time and then read them out at a later time. This methodology can also be used to simultaneously measure TF binding and mRNA expression from single-cell CC and to record and integrate TF binding events across time in any cell type of interest without the need for purification. Despite these advantages, there has been a lack of dedicated bioinformatics tools for the detailed analysis of CC data.<h4>Results</h4>We introduce Pycallingcards, a comprehensive Python module specifically designed for the analysis of single-cell and bulk CC data across multiple species. Pycallingcards introduces two innovative peak callers, CCcaller and MACCs, enhancing the accuracy and speed of pinpointing TF binding sites from CC data. Pycallingcards offers a fully integrated environment for data visualization, motif finding, and comparative analysis with RNA-seq and ChIP-seq datasets. To illustrate its practical application, we have reanalyzed previously published mouse cortex and glioblastoma datasets. This analysis revealed novel cell-type-specific binding sites and potential sex-linked TF regulators, furthering our understanding of TF binding and gene expression relationships. Thus, Pycallingcards, with its user-friendly design and seamless interface with the Python data science ecosystem, stands as a critical tool for advancing the analysis of TF functions via CC data.<h4>Availability and implementation</h4>Pycallingcards can be accessed on the GitHub repository: https://github.com/The-Mitra-Lab/pycallingcards.

DARS2
Also flagged:KetoneBDH1mitochondriafatty acidmitochondrialpyruvate
Journal Article 2024-02-01 ✓ 1 Snippet Williams AS, Crown SB, Lyons SP, Koves TR, Wilson RJ, Johnson JM, Slentz DH, Kelly DP, Grimsrud PA, Zhang GF, Muoio DM.
In-Text Gene Mentions

Dars2

Show Full Abstract

Time-restricted feeding (TRF) has gained attention as a dietary regimen that promotes metabolic health. This study questioned if the health benefits of an intermittent TRF (iTRF) schedule require ketone flux specifically in skeletal and cardiac muscles. Notably, we found that the ketolytic enzyme beta-hydroxybutyrate dehydrogenase 1 (BDH1) is uniquely enriched in isolated mitochondria derived from heart and red/oxidative skeletal muscles, which also have high capacity for fatty acid oxidation (FAO). Using mice with BDH1 deficiency in striated muscles, we discover that this enzyme optimizes FAO efficiency and exercise tolerance during acute fasting. Additionally, iTRF leads to robust molecular remodeling of muscle tissues, and muscle BDH1 flux does indeed play an essential role in conferring the full adaptive benefits of this regimen, including increased lean mass, mitochondrial hormesis, and metabolic rerouting of pyruvate. In sum, ketone flux enhances mitochondrial bioenergetics and supports iTRF-induced remodeling of skeletal muscle and heart.

HFE
Also flagged:Iron deficiencyIDnutritional deficiencyanemiaHbiron
Journal Article 2024-02-01 ✓ 3 Snippets Díaz-Torres S, Díaz-López A, Arija V.
In-Text Gene Mentions

In each trimester of pregnancy, blood samples were collected for biochemical determinations (Hb and serum ferritin and cortisol) and for DNA extraction (HFE gene).

…alteration in theHFEgene of hereditary…

…Genetic determinations ofHFEgene mutations (C282Y,…

Show Full Abstract

In this randomized clinical trial, we evaluated the effects of prenatal iron supplementation adapted to pregnant women's initial hemoglobin (Hb) levels on fetal growth parameters until birth in women from the Mediterranean coast of northern Spain. All (<i>n</i> = 791) women were iron-supplemented during pregnancy according to Hb levels at the 12th gestational week: stratum 1 (Hb: 110-130 g/L) received 40 or 80 mg iron daily; stratum 2 (Hb > 130 g/L) received 40 or 20 mg iron daily. Fetal biometric and anthropometric measurements were evaluated in the three trimesters and at birth, respectively. In stratum 1, using 80 mg/d instead of 40 mg/d increased the risk of fetal head circumference > 90th percentile (OR = 2.49, <i>p</i> = 0.015) at the second trimester and fetal weight (OR = 2.36, <i>p</i> = 0.011) and femur length (OR = 2.50, <i>p</i> = 0.018) < 10th percentile at the third trimester. For stratum 2, using 40 mg/d instead of 20 mg/d increased the risk of fetal head circumference > 90th percentile (OR = 3.19, <i>p</i> = 0.039) at the third trimester. A higher risk of delivering an LGA baby (OR = 2.35, <i>p</i> = 0.015) for birthweight was also observed in stratum 1 women receiving 80 mg/d. It is crucial to adjust the prenatal iron supplementation to each pregnant woman's needs, i.e., adapted to their initial Hb levels, to achieve optimal fetal development, since excessive iron doses appear to adversely influence fetal growth.

HTT
Also flagged:cognitionbehavioralgene expressionneurotransmitter receptorsParkinson's diseasePD
Journal Article 2024-02-01 ✓ 2 Snippets Dong X, Li Q, Wang X, He Y, Zeng D, Chu L, Zhao K, Li S.
In-Text Gene Mentions

These data were acquired through positron emission tomography (PET) and covered the following neurotransmitter systems: serotonin (5‐HT1A, 5‐HT1B, 5‐HT2A 5‐HT4, 5‐HT6, 5‐HTT), dopamine (D1, D2, DAT), norepinephrine (NET), histamine (H3), acetylcholine (α4β2, M1, VAchT), cannabinoid (CB1), opioid (MOR), glutamate (NMDA, mGluR5), and GABA (GABAA/BZ).

…5‐HT2A 5‐HT4, 5‐HT6, 5‐HTT), dopamine (D1, D2,…

Show Full Abstract

Functional signals emerge from the structural network, supporting multiple cognitive processes through underlying molecular mechanism. The link between human brain structure and function is region-specific and hierarchical across the neocortex. However, the relationship between hierarchical structure-function decoupling and the manifestation of individual behavior and cognition, along with the significance of the functional systems involved, and the specific molecular mechanism underlying structure-function decoupling remain incompletely characterized. Here, we used the structural-decoupling index (SDI) to quantify the dependency of functional signals on the structural connectome using a significantly larger cohort of healthy subjects. Canonical correlation analysis (CCA) was utilized to assess the general multivariate correlation pattern between region-specific SDIs across the whole brain and multiple cognitive traits. Then, we predicted five composite cognitive scores resulting from multivariate analysis using SDIs in primary networks, association networks, and all networks, respectively. Finally, we explored the molecular mechanism related to SDI by investigating its genetic factors and relationship with neurotransmitter receptors/transporters. We demonstrated that structure-function decoupling is hierarchical across the neocortex, spanning from primary networks to association networks. We revealed better performance in cognition prediction is achieved by using high-level hierarchical SDIs, with varying significance of different brain regions in predicting cognitive processes. We found that the SDIs were associated with the gene expression level of several receptor-related terms, and we also found the spatial distributions of four receptors/transporters significantly correlated with SDIs, namely D2, NET, MOR, and mGluR5, which play an important role in the flexibility of neuronal function. Collectively, our findings corroborate the association between hierarchical macroscale structure-function decoupling and individual cognition and provide implications for comprehending the molecular mechanism of structure-function decoupling. PRACTITIONER POINTS: Structure-function decoupling is hierarchical across the neocortex, spanning from primary networks to association networks. High-level hierarchical structure-function decoupling contributes much more than low-level decoupling to individual cognition. Structure-function decoupling could be regulated by genes associated with pivotal receptors that are crucial for neuronal function flexibility.

LRRC7
Also flagged:NCAPHbreast cancerbreast cancerspathogenesisgene expressionbreast tumours
Journal Article 2024-02-01 ✓ 1 Snippet Mendiburu-Eliçabe M, García-Sancha N, Corchado-Cobos R, Martínez-López A, Chang H, Hua Mao J, Blanco-Gómez A, García-Casas A, Castellanos-Martín A, Salvador N, Jiménez-Navas A, Pérez-Baena MJ, Sánchez-Martín MA, Abad-Hernández MDM, Carmen SD, Claros-Ampuero J, Cruz-Hernández JJ, Rodríguez-Sánchez CA, García-Cenador MB, García-Criado FJ, Vicente RS, Castillo-Lluva S, Pérez-Losada J.
In-Text Gene Mentions

Condensinsare large protein…

Show Full Abstract

<h4>Background</h4>Luminal A tumours generally have a favourable prognosis but possess the highest 10-year recurrence risk among breast cancers. Additionally, a quarter of the recurrence cases occur within 5 years post-diagnosis. Identifying such patients is crucial as long-term relapsers could benefit from extended hormone therapy, while early relapsers might require more aggressive treatment.<h4>Methods</h4>We conducted a study to explore non-structural chromosome maintenance condensin I complex subunit H's (NCAPH) role in luminal A breast cancer pathogenesis, both in vitro and in vivo, aiming to identify an intratumoural gene expression signature, with a focus on elevated NCAPH levels, as a potential marker for unfavourable progression. Our analysis included transgenic mouse models overexpressing NCAPH and a genetically diverse mouse cohort generated by backcrossing. A least absolute shrinkage and selection operator (LASSO) multivariate regression analysis was performed on transcripts associated with elevated intratumoural NCAPH levels.<h4>Results</h4>We found that NCAPH contributes to adverse luminal A breast cancer progression. The intratumoural gene expression signature associated with elevated NCAPH levels emerged as a potential risk identifier. Transgenic mice overexpressing NCAPH developed breast tumours with extended latency, and in Mouse Mammary Tumor Virus (MMTV)-NCAPH<sup>ErbB2</sup> double-transgenic mice, luminal tumours showed increased aggressiveness. High intratumoural Ncaph levels correlated with worse breast cancer outcome and subpar chemotherapy response. A 10-gene risk score, termed Gene Signature for Luminal A 10 (GSLA10), was derived from the LASSO analysis, correlating with adverse luminal A breast cancer progression.<h4>Conclusions</h4>The GSLA10 signature outperformed the Oncotype DX signature in discerning tumours with unfavourable outcomes, previously categorised as luminal A by Prediction Analysis of Microarray 50 (PAM50) across three independent human cohorts. This new signature holds promise for identifying luminal A tumour patients with adverse prognosis, aiding in the development of personalised treatment strategies to significantly improve patient outcomes.

Also flagged:deliriumAlzheimer's diseasecognitive declinedementiasimmune responsepostoperative delirium
Journal Article 2024-02-01 No Snippets Leung JM, Rojas JC, Sands LP, Chan B, Rajbanshi B, Du Z, Du P, Perioperative Medicine Research group.
Show Full Abstract

<h4>Background</h4>Postoperative delirium is prevalent in older adults and has been shown to increase the risk of long-term cognitive decline. Plasma biomarkers to identify the risk for postoperative delirium and the risk of Alzheimer's disease and related dementias are needed.<h4>Methods</h4>This biomarker discovery case-control study aimed to identify plasma biomarkers associated with postoperative delirium. Patients aged ≥65 years undergoing major elective noncardiac surgery were recruited. The preoperative plasma proteome was interrogated with SOMAmer-based technology targeting 1433 biomarkers.<h4>Results</h4>In 40 patients (20 with vs. 20 without postoperative delirium), a preoperative panel of 12 biomarkers discriminated patients with postoperative delirium with an accuracy of 97.5%. The final model of five biomarkers delivered a leave-one-out cross-validation accuracy of 80%. Represented biological pathways included lysosomal and immune response functions.<h4>Conclusion</h4>In older patients who have undergone major surgery, plasma SOMAmer proteomics may provide a relatively non-invasive benchmark to identify biomarkers associated with postoperative delirium.

Also flagged:cell activationTumorscancerautoimmune diseasesinfectious diseasesB7
Journal Article 2024-02-01 No Snippets Burke KP, Chaudhri A, Freeman GJ, Sharpe AH.
Show Full Abstract

Immune responses must be tightly regulated to ensure both optimal protective immunity and tolerance. Costimulatory pathways within the B7:CD28 family provide essential signals for optimal T cell activation and clonal expansion. They provide crucial inhibitory signals that maintain immune homeostasis, control resolution of inflammation, regulate host defense, and promote tolerance to prevent autoimmunity. Tumors and chronic pathogens can exploit these pathways to evade eradication by the immune system. Advances in understanding B7:CD28 pathways have ushered in a new era of immunotherapy with effective drugs to treat cancer, autoimmune diseases, infectious diseases, and transplant rejection. Here, we discuss current understanding of the mechanisms underlying the coinhibitory functions of CTLA-4, PD-1, PD-L1:B7-1 and PD-L2:RGMb interactions and less studied B7 family members, including HHLA2, VISTA, BTNL2, and BTN3A1, as well as their overlapping and unique roles in regulating immune responses, and the therapeutic potential of these insights.

HFE
Also flagged:metabolismdetoxificationliver illnessesliver disordersrifampinisoniazid
Journal Article 2024-02-01 ✓ 1 Snippet Islam Shawon S, Nargis Reyda R, Qais N.
In-Text Gene Mentions

…liver disease, andhemochromatosis.…

Show Full Abstract

The liver is an essential organ that helps the body with immunity, metabolism, and detoxification, among other functions. Worldwide, liver illnesses are a leading cause of mortality and disability. There are few effective treatment choices, but they frequently have unfavorable side effects. Investigating the potential of medicinal plants and their bioactive phytoconstituents in the prevention and treatment of liver disorders has gained more attention in recent years. An assessment of the hepatoprotective potential of medicinal plants and their bioactive secondary metabolites is the goal of this thorough review paper. To determine their hepatoprotective activity, these plants were tested against liver toxicity artificially induced in rats, mice and rabbits by chemical agents such as carbon tetrachloride (CCl<sub>4</sub>), paracetamol (PCM), thioacetamide (TAA), N-nitrosodiethylamine, d-galactosamine/lipopolysaccharide, antitubercular medicines (rifampin, isoniazid) and alcohol. To find pertinent research publications published between 1989 and 2022, a comprehensive search of electronic bibliographic databases (including Web of Science, SpringerLink, ScienceDirect, Google Scholar, PubMed, Scopus, and others) was carried out. The investigation comprised 203 plant species from 81 families in total. A thorough discussion was mentioned regarding the hepatoprotective qualities of plants belonging to several families, such as Fabaceae, Asteraceae, Lamiaceae, and Euphorbiaceae. The plant groups Asteraceae and Fabaceae were the most frequently shown to have hepatoprotective properties. The phytochemical constituents namely flavonoids, phenolic compounds, and alkaloids exhibited the highest frequency of hepatoprotective action. Also, some possible mechanism of action of some active constituents from medicinal plants was discussed in brief which were found in some studies. In summary, the information on medicinal plants and their potentially hepatoprotective bioactive phytoconstituents has been consolidated in this review which emphasizes the importance of further research to explore the efficacy and safety of these natural remedies for various liver ailments.

Also flagged:bone diseaseaginginfectioncollagenchitosanpolylactic acid
Journal Article 2024-02-01 No Snippets Nielson C, Agarwal J, Beck JP, Shea J, Jeyapalina S.
Show Full Abstract

Hydroxyapatite (HA)-based materials are widely used as bone substitutes due to their inherent biocompatibility, osteoconductivity, and bio-absorption properties. However, HA scaffolds lack compressive strength when compared to autograft bone. It has been shown that the fluoridated form of HA, fluorapatite (FA), can be sintered to obtain this desired strength as well as slower degradation properties. Also, FA surfaces have been previously shown to promote stem cell differentiation toward an osteogenic lineage. Thus, it was hypothesized that FA, with and without stromal vascular fraction (SVF), would guide bone healing to an equal or better extent than the clinical gold standard. The regenerative potentials of these scaffolds were tested in 32 Lewis rats in a femoral condylar defect model with untreated (negative), isograft (positive), and commercial HA as controls. Animals were survived for 12 weeks post-implantation. A semi-quantitative micro-CT analysis was developed to quantify the percent new bone formation within the defects. Our model showed significantly higher (p < .05) new bone depositions in all apatite groups compared to the autograft group. Overall, the FA group had the most significant new bone deposition, while the differences between HA, FA, and FA + SVF were insignificant (p > .05). Histological observations supported the micro-CT findings and highlighted the presence of healthy bone tissues without interposing capsules or intense immune responses for FA groups. Most importantly, the regenerating bone tissue within the FA + SVF scaffolds resembled the architecture of the surrounding trabecular bone, showing intertrabecular spaces, while the FA group presented a denser cortical bone-like architecture. Also, a lower density of cells was observed near FA granules compared to HA surfaces, suggesting a reduced immune response. This first in vivo rat study supported the tested hypothesis, illustrating the utility of FA as a bone scaffold material.

Also flagged:antisocial personality disordergene expressionneurological disorderdissocial personality disordercognitive impairmentneurodegenerative diseases
Journal Article 2024-02-01 No Snippets Mušálková D, Přistoupilová A, Jedličková I, Hartmannová H, Trešlová H, Nosková L, Hodaňová K, Bittmanová P, Stránecký V, Jiřička V, Langmajerová M, Woodbury-Smith M, Zarrei M, Trost B, Scherer SW, Bleyer AJ, Vevera J, Kmoch S.
Show Full Abstract

The genetic correlates of extreme impulsive violence are poorly understood, and there have been few studies that have characterized a large group of affected individuals both clinically and genetically. We performed whole exome sequencing (WES) in 290 males with the life-course-persistent, extremely impulsively violent form of antisocial personality disorder (APD) and analyzed the spectrum of rare protein-truncating variants (rPTVs). Comparisons were made with 314 male controls and publicly available genotype data. Functional annotation tools were used for biological interpretation. Participants were significantly more likely to harbor rPTVs in genes that are intolerant to loss-of-function variants (odds ratio [OR] 2.06; p < 0.001), specifically expressed in brain (OR 2.80; p = 0.036) and enriched for those involved in neurotransmitter transport and synaptic processes. In 60 individuals (20%), we identified rPTVs that we classified as clinically relevant based on their clinical associations, biological function and gene expression patterns. Of these, 37 individuals harbored rPTVs in 23 genes that are associated with a monogenic neurological disorder, and 23 individuals harbored rPTVs in 20 genes reportedly intolerant to loss-of-function variants. The analysis presents evidence in support of a model where presence of either one or several private, functionally relevant mutations contribute significantly to individual risk of life-course-persistent APD and reveals multiple individuals who could be affected by clinically unrecognized neuropsychiatric Mendelian disease. Thus, Mendelian diseases and increased rPTV burden may represent important factors for the development of extremely impulsive violent life-course-persistent forms of APD irrespective of their clinical presentation.

Also flagged:cancertumorbreast cancerimmune responsebile acidsbenign breast tumors
Journal Article 2024-02-01 No Snippets Nguyen SM, Tran HTT, Long J, Shrubsole MJ, Cai H, Yang Y, Nguyen LM, Nguyen GH, Nguyen CV, Ta TV, Wu J, Cai Q, Zheng W, Tran TV, Shu XO.
Show Full Abstract

<h4>Purpose</h4>Gut microbiota play an important role in human health, including cancer. Cancer and its treatment, in turn, may alter the gut microbiome. To understand this complex relationship, we profiled the gut microbiome of 356 Vietnamese patients with breast cancer.<h4>Materials and methods</h4>Stool samples were collected before chemotherapy, with 162 pre- and 194 postsurgery. The gut microbiome was measured by shotgun metagenomic sequencing. Associations of gut microbial diversity, taxa abundance, and gut microbiome health index (GMHI) with sociodemographic, clinical factors, and tumor characteristics were evaluated.<h4>Results</h4>Postsurgery samples were associated with significantly lower α- and β-diversities (<i>P</i> < .001) and showed significant differences in the abundance of 15% of 2,864 investigated taxa (false discovery rate [FDR] <0.1) compared with presurgery samples. An unhealthy gut microbiome was prevalent among patients with breast cancer, with a mean GMHI of -0.79 and -2.81 in pre- and postsurgery stool samples, respectively. In an analysis of 162 presurgery stool samples, diagnosis delay was significantly associated with lower α-diversity, variation in β-diversity, an increased abundance of species <i>Enorma massiliensis</i>, and a decreased abundance of <i>Faecalicoccus pleomorphus</i>. High intake of fiber was significantly associated with lower α-diversity and a higher abundance of species belonging to <i>Bifidobacterium</i>, <i>Prevotella</i>, and <i>Bacteroides</i> gena (FDR < 0.1). We did not find that cancer stage and subtype, menopausal status, comorbidity, antibiotic use during 3 months before stool collection, or physical activity was significantly associated with α- and β-diversities or GMHI although a few significant differences were observed in taxa abundance.<h4>Conclusion</h4>Our study revealed that diagnosis delay, high fiber intake, and breast cancer surgery, which is always followed by antibiotic prophylaxis in Vietnam, led to a less diverse and unhealthy gut microbiome among patients with breast cancer.

Also flagged:cancerscancertumorliver canceraristolochic acidstumors
Journal Article 2024-02-01 No Snippets Youk J, Kwon HW, Lim J, Kim E, Kim T, Kim R, Park S, Yi K, Nam CH, Jeon S, An Y, Choi J, Na H, Lee ES, Cho Y, Min DW, Kim H, Kang YR, Choi SH, Bae MJ, Lee CG, Kim JG, Kim YS, Yu T, Lee WC, Shin JY, Lee DS, Kim TY, Ku T, Kim SY, Lee JH, Koo BK, Lee H, Yi OV, Han EC, Chang JH, Kim KS, Son TG, Ju YS.
Show Full Abstract

The comprehensive genomic impact of ionizing radiation (IR), a carcinogen, on healthy somatic cells remains unclear. Using large-scale whole-genome sequencing (WGS) of clones expanded from irradiated murine and human single cells, we revealed that IR induces a characteristic spectrum of short insertions or deletions (indels) and structural variations (SVs), including balanced inversions, translocations, composite SVs (deletion-insertion, deletion-inversion, and deletion-translocation composites), and complex genomic rearrangements (CGRs), including chromoplexy, chromothripsis, and SV by breakage-fusion-bridge cycles. Our findings suggest that 1 Gy IR exposure causes an average of 2.33 mutational events per Gb genome, comprising 2.15 indels, 0.17 SVs, and 0.01 CGRs, despite a high level of inter-cellular stochasticity. The mutational burden was dependent on total irradiation dose, regardless of dose rate or cell type. The findings were further validated in IR-induced secondary cancers and single cells without clonalization. Overall, our study highlights a comprehensive and clear picture of IR effects on normal mammalian genomes.

HTT
Also flagged:major depressive disorderpsychiatric disordercognitiondepressionneurogenesisaxonal
Journal Article 2024-02-01 ✓ 2 Snippets Videtta G, Squarcina L, Prunas C, Brambilla P, Delvecchio G.
In-Text Gene Mentions

Indeed, decreased levels of serotonin were observed in MDD (6), maybe due to deficits in the serotonin transporter (5-HTT) within raphe nuclei, at the level of brainstem (7), or within the amygdala and midbrain (8), as well as in the hippocampus, whose neurochemical disruption has been suggested to contribute to developing depressive and anxiety behaviors (9).

…the serotonin transporter (5-HTT) within raphe nuclei,…

Show Full Abstract

Major Depressive Disorder (MDD) is a severe psychiatric disorder characterized by selective impairments in mood regulation, cognition and behavior. Although it is well-known that antidepressants can effectively treat moderate to severe depression, the biochemical effects of these medications on white matter (WM) integrity are still unclear. Therefore, the aim of the study is to review the main scientific evidence on the differences in WM integrity in responders and non-responders to antidepressant medications. A record search was performed on three datasets (PubMed, Scopus and Web of Science) and ten records matched our inclusion criteria. Overall, the reviewed studies highlighted a good efficacy of antidepressants in MDD treatment. Furthermore, there were differences in WM integrity between responders and non-responders, mainly localized in cingulate cortices, hippocampus and corpus callosum, where the former group showed higher fractional anisotropy and lower axial diffusivity values. Modifications in WM integrity might be partially explained by branching and proliferation as well as neurogenesis of axonal fibers mediated by antidepressants, which in turn may have positively affected brain metabolism and increase the quantity of the serotonergic neurotransmitter within synaptic clefts. However, the reviewed studies suffer from some limitations, including the heterogeneity in treatment duration, antidepressant administration, medical posology, and psychiatric comorbidities. Therefore, future studies are needed to reduce confounding effects of antidepressant medications and to adopt longitudinal and multimodal approaches in order to better characterize the differences in WM integrity between responders and non-responders.

DCC
Also flagged:psychiatric disordersasthmaallergyclozapinelithium5-HT2 receptor
Journal Article 2024-02-01 ✓ 1 Snippet Ajayi T, Thomas A, Nikolic M, Henderson L, Zaheri A, Dwyer DS.
In-Text Gene Mentions

…phenotype clusters, whileDCC, GALNT10, NKAIN2, PDE4B…

Show Full Abstract

<h4>Background</h4>Genome wide association studies (GWAS) and candidate gene analyses have identified genetic variants and genes that may increase the risk for suicidal thoughts and behaviors (STBs). Important unresolved issues surround these tentative risk variants such as the characteristics of the associated genes and how they might elicit STBs.<h4>Methods</h4>Putative suicidality-related risk genes (PSRGs) were identified by comprehensive literature search and were characterized with respect to evolutionary conservation, participation in gene interaction networks and associated phenotypes. Evolutionary conservation was established with database searches and BLASTP queries, whereas gene-gene interactions were ascertained with GeneMANIA. We then examined whether mutations in risk-gene counterparts in <i>C. elegans</i> produced a diminished motivation phenotype previously connected to suicide risk factors.<h4>Results and conclusions</h4>From the analysis, 105 risk-gene candidates were identified and found to be: 1) highly conserved during evolution, 2) enriched for essential genes, 3) involved in significant gene-gene interactions, and 4) associated with psychiatric disorders, metabolic disturbances and asthma/allergy. Evaluation of 17 mutant strains with loss-of-function/deletion mutations in PSRG orthologs revealed that 11 mutants showed significant evidence of diminished motivation that manifested as immobility in a foraging assay. Immobility was corrected in some or all of the mutants with clozapine, lithium and tricyclic antidepressant drugs. In addition, 5-HT2 receptor and muscarinic receptor antagonists restored goal-directed behavior in most or all of the mutants. These studies increase confidence in the validity of the PSRGs and provide initial clues about possible mechanisms that mediate STBs.

VRK2HTT
Also flagged:proteostasislocalisationCCTcell cycleautophagyadaptive immunity
Journal Article 2024-02-01 ✓ 2 Snippets Zeng C, Han S, Pan Y, Huang Z, Zhang B, Zhang B.
In-Text Gene Mentions

These studies indicated that TRiC/CCT dysfunction causes HD and that VRK2 may be a key regulatory protein in this pathological process.

Treatments directed at inhibiting the accumulation of toxic products of the mutant HTT gene may constitute a direct strategy for targeting the root cause of HD pathogenesis.99

Show Full Abstract

<h4>Background</h4>Disrupted protein homeostasis (proteostasis) has been demonstrated to facilitate the progression of various diseases. The cytosolic T-complex protein-1 ring complex (TRiC/CCT) was discovered to be a critical player in orchestrating proteostasis by folding eukaryotic proteins, guiding intracellular localisation and suppressing protein aggregation. Intensive investigations of TRiC/CCT in different fields have improved the understanding of its role and molecular mechanism in multiple physiological and pathological processes.<h4>Main body</h4>In this review, we embark on a journey through the dynamic protein folding cycle of TRiC/CCT, unraveling the intricate mechanisms of its substrate selection, recognition, and intriguing folding and assembly processes. In addition to discussing the critical role of TRiC/CCT in maintaining proteostasis, we detail its involvement in cell cycle regulation, apoptosis, autophagy, metabolic control, adaptive immunity and signal transduction processes. Furthermore, we meticulously catalogue a compendium of TRiC-associated diseases, such as neuropathies, cardiovascular diseases and various malignancies. Specifically, we report the roles and molecular mechanisms of TRiC/CCT in regulating cancer formation and progression. Finally, we discuss unresolved issues in TRiC/CCT research, highlighting the efforts required for translation to clinical applications, such as diagnosis and treatment.<h4>Conclusion</h4>This review aims to provide a comprehensive view of TRiC/CCT for researchers to inspire further investigations and explorations of potential translational possibilities.

Also flagged:Oral squamous cell carcinomaOSCCoral cancerRaf kinase inhibitor proteinRKIPtumor
Journal Article 2024-02-01 No Snippets Luo T, Xu T, Ou Y, Ci H, Sun J.
Show Full Abstract

<h4>Background</h4>The expression of RKIP, TGM2, and CMTM4 in oral squamous cell carcinoma (OSCC) and normal oral tissues was detected and their correlations were analyzed. The relationships between RKIP, TGM2, and CMTM4 and the clinicopathological parameters and prognosis of patients were analyzed.<h4>Methods</h4>Seventy cancerous and adjacent normal tissue samples were selected, recorded in the pathology department, and embedded in paraffin. Protein expression was detected by immunohistochemistry. Statistical software (SPSS 25.0, IBM Corporation) was used for the statistical analysis. The chi-squared (χ2) test was used to analyze the expression of RKIP, TGM2, and CMTM4 proteins and their clinicopathological features. Differences in RKIP, TGM2, and CMTM4 protein levels between OSCC and normal tissues were compared using a χ2 test. Survival analysis was performed using the Kaplan-Meier method, and differences between survival curves were determined using the log-rank test. The effects of RKIP, TGM2, and CMTM4 expression on patient prognosis were analyzed using a multivariate Cox proportional hazards regression model. P < .05 was considered statistically significant.<h4>Results</h4>The expression level of RKIP correlated with age and clinical stage (P < .05). TGM2 was associated with clinical stage and lymph node metastasis (P < .05). The expression of CMTM4 increased with a decrease in cancer differentiation. Kaplan-Meier survival analysis suggested that the positive expression of TGM2 and CMTM4 may predict poor prognosis in patients with OSCC. The multivariate Cox proportional hazards regression model suggested that TGM2 could be an independent prognostic factor for patients with OSCC.<h4>Conclusion</h4>Combined expression of TGM2 and CMTM4 can be used as an indicator to evaluate the risk of metastasis and prognosis of OSCC.

TNFSF4
Also flagged:deathcancergastric cancergene expressiontumorprogrammed cell death
Journal Article 2024-02-01 ✓ 1 Snippet Wen L, Xu K, Huang M, Pan Q.
In-Text Gene Mentions

…CD28, CD200R1, PDCD1LG2,TNFSF4, CD200, CD276, TNFSF18,…

Show Full Abstract

As a novel form of cell death, oxeiptosis is mainly caused by oxidative stress and has been defined to contribute to the cellular death program in cancer. However, the precise involvement of oxeiptosis-related long non-coding RNAs (lncRNAs) within gastric cancer (GC) remains elusive. Thus, our study was aimed to elucidate the pivotal effect of hub oxeiptosis-related lncRNAs on GC by comprehensively analyzing lncRNA and gene expression data obtained from The Cancer Genome Atlas (TCGA) database. Subsequently, we constructed a risk signature (risk-sig) using lncRNAs and further evaluated its prognostic significance. We successfully identified thirteen lncRNAs closely related with oxeiptosis that exhibited significant relevance to the prognosis of GC, forming the foundation of our meticulously constructed risk-sig. Notably, our clinical analyses unveiled a strong correlation between the risk-sig and crucial clinical parameters including overall survival (OS), gender, TNM stage, grade, M stage, and N stage among GC patients. Intriguingly, the diagnostic accuracy of this risk-sig surpassed that of conventional clinicopathological characteristics, underscoring its potential as a highly informative prognostic tool. In-depth mechanistic investigations further illuminated a robust association between this risk-sig and fundamental biological processes such as tumor stemness, immune cell infiltration, and immune subtypes. These findings provide valuable insights into the complex interplay between oxeiptosis-related lncRNAs and the intricate molecular landscape of GC. Ultimately, leveraging the risk scores derived from our comprehensive analysis, we successfully developed a nomogram that enables accurate prediction of GC prognosis. Collectively, our study established a solid foundation for the integration of thirteen hub oxeiptosis-related lncRNAs into a clinically applicable risk-sig, potentially revolutionizing prognostic assessment in GC and facilitating the development of innovative therapeutic strategies.

Also flagged:gliomaIDHgliomashematoxylinbrain tumorATRX
Journal Article 2024-02-01 No Snippets Lv Q, Liu Y, Sun Y, Wu M.
Show Full Abstract

<h4>Background</h4>Deep learning techniques explain the enormous potential of medical image analysis, particularly in digital pathology. Concurrently, molecular markers have gained increasing significance over the past decade in the context of glioma patients, providing novel insights into diagnosis and more personalized treatment options. Deep learning combined with imaging and molecular analysis enables more accurate prognostication of patients, more accurate treatment plan proposals, and accurate biomarker (IDH) prediction for gliomas. This systematic study examines the development of deep learning techniques for IDH prediction using histopathology images, spanning the period from 2019 to 2023.<h4>Method</h4>The study adhered to the PRISMA reporting requirements, and databases including PubMed, Google Scholar, Google Search, and preprint repositories (such as arXiv) were systematically queried for pertinent literature spanning the period from 2019 to the 30th of 2023. Search phrases related to deep learning, digital pathology, glioma, and IDH were collaboratively utilized.<h4>Results</h4>Fifteen papers meeting the inclusion criteria were included in the analysis. These criteria specifically encompassed studies utilizing deep learning for the analysis of hematoxylin and eosin images to determine the IDH status in patients with gliomas.<h4>Conclusions</h4>When predicting the status of IDH, the classifier built on digital pathological images demonstrates exceptional performance. The study's predictive effectiveness is enhanced with the utilization of the appropriate deep learning model. However, external verification is necessary to showcase their resilience and universality. Larger sample sizes and multicenter samples are necessary for more comprehensive research to evaluate performance and confirm clinical advantages.

Also flagged:agingcalciummitochondrialoxygenneurodegenerative diseasesAlzheimer's disease
Journal Article 2024-02-01 No Snippets Fan H, Zhang M, Wen J, Wang S, Yuan M, Sun H, Shu L, Yang X, Pu Y, Cai Z.
Show Full Abstract

Aging is characterized by progressive degeneration of tissues and organs, and it is positively associated with an increased mortality rate. The brain, as one of the most significantly affected organs, experiences age-related changes, including abnormal neuronal activity, dysfunctional calcium homeostasis, dysregulated mitochondrial function, and increased levels of reactive oxygen species. These changes collectively contribute to cognitive deterioration. Aging is also a key risk factor for neurodegenerative diseases, such as Alzheimer's disease and Parkinson's disease. For many years, neurodegenerative disease investigations have primarily focused on neurons, with less attention given to microglial cells. However, recently, microglial homeostasis has emerged as an important mediator in neurological disease pathogenesis. Here, we provide an overview of brain aging from the perspective of the microglia. In doing so, we present the current knowledge on the correlation between brain aging and the microglia, summarize recent progress of investigations about the microglia in normal aging, Alzheimer's disease, Parkinson's disease, Huntington's disease, and amyotrophic lateral sclerosis, and then discuss the correlation between the senescent microglia and the brain, which will culminate with a presentation of the molecular complexity involved in the microglia in brain aging with suggestions for healthy aging.

SOX6
Also flagged:RUNX2transcription factorchondrocyte maturationchondrogenesisCol10a1hypertrophic
Journal Article 2024-02-01 ✓ 1 Snippet Kaur G, Wu B, Murali S, Lanigan T, Coleman RM.
In-Text Gene Mentions

Sox6

Show Full Abstract

The transcription factor RUNX2 is a key regulator of chondrocyte phenotype during development, making it an ideal target for prevention of undesirable chondrocyte maturation in cartilage tissue-engineering strategies. Here, we engineered an autoregulatory gene circuit (cisCXp-shRunx2) that negatively controls RUNX2 activity in chondrogenic cells via RNA interference initiated by a tunable synthetic Col10a1-like promoter (cisCXp). The cisCXp-shRunx2 gene circuit is designed based on the observation that induced RUNX2 silencing after early chondrogenesis enhances the accumulation of cartilaginous matrix in ATDC5 cells. We show that the cisCXp-shRunx2 initiates RNAi of RUNX2 in maturing chondrocytes in response to the increasing intracellular RUNX2 activity without interfering with early chondrogenesis. The induced loss of RUNX2 activity in turn negatively regulates the gene circuit itself. Moreover, the efficacy of RUNX2 suppression from cisCXp-shRunx2 can be controlled by modifying the sensitivity of cisCXp promoter. Finally, we show the efficacy of inhibiting RUNX2 in preventing matrix loss in human mesenchymal stem cell-derived (hMSC-derived) cartilage under conditions that induce chondrocyte hypertrophic differentiation, including inflammation. Overall, our results demonstrated that the negative modulation of RUNX2 activity with our autoregulatory gene circuit enhanced matrix synthesis and resisted ECM degradation by reprogrammed MSC-derived chondrocytes in response to the microenvironment of the degenerative joint.

HFE
Also flagged:Iron overload disordersironchronic liver diseasehereditary hemochromatosisHHTFR2
Journal Article 2024-02-01 ✓ 4 Snippets Sohal A, Kowdley KV.
In-Text Gene Mentions

…TheHFEgene C282Y homozygous…

hemochromatosis

HFE hemochromatosis

HFE

Show Full Abstract

Iron overload disorders are conditions that can lead to increased body iron stores and end-organ damage in affected organs. Increased iron deposition most commonly occurs in the liver, heart, endocrine system, joints, and pancreas. Iron overload disorders may be caused by genetic or acquired causes (transfusion, dyserythropoiesis, and chronic liver disease). The <i>HFE</i> gene C282Y homozygous mutation is the most common cause of hereditary hemochromatosis (HH). Other genes implicated in HH include <i>TFR2</i>, <i>HAMP, HJV,</i> and <i>SLC40A1</i>. In the past 2 decades, there have been major advances in the understanding of genetic iron overload disorders. Furthermore, new novel techniques to measure iron content in organs noninvasively, as well as new therapeutic options for the treatment of HH, are currently under development. This article focuses on the latest concepts in understanding, diagnosing, and managing genetic iron overload disorders, particularly HH.

DCC
Also flagged:colorectal cancerdeoxyribonucleic acidpolymerase
Journal Article 2024-02-01 ✓ 1 Snippet Serwer T, Wahid M, Imtiaz F, Memon AS.
In-Text Gene Mentions

…mutation of theDCCGene in the…

Show Full Abstract

<h4>Objective</h4>To identify the mutation in codon 201 of the deleted in colorectal cancer gene in colorectal cancer, and to correlate that mutation to the histopathological grading of colorectal cancer.<h4>Methods</h4>The cross-sectional study was conducted from February 2019 to February 2021 after approval from the ethics review board of the Dow University of Health Sciences, Karachi, and comprised biopsy-proven colorectal cancer patients regardless of age and gender. After histopathological reporting, formalin-fixed paraffin-embedded tissue blocks of colorectal cancer were used for deoxyribonucleic acid extraction, followed by polymerase chain reaction optimisation and deoxyribonucleic acid Sanger sequencing for mutational analysis. Data was analysed using SPSS 25.<h4>Results</h4>Of the 100 biopsy specimens assessed, 45(45%) were selected. Of them, 13(29%) samples failed to show any band on gel electrophoresis. The remaining 32(71%) samples were used for Sanger sequencing. Of these, 1(3%) sample did not sequence, while 31(97%) showed sequencing. All the sequenced samples identified a mutation in codon 201 of exon 3 in the deleted in colorectal cancer gene; 30(97%) showed homozygosity, and 1(3%) showed heterozygosity. No significant association of point mutation was noted with various demographic and clinicopathological parameters (p>0.05).<h4>Conclusion</h4>The deleted in colorectal cancer gene's missense mutation in codon 201 was frequently observed in colorectal cancer patients.

HFE
Also flagged:systemic light-chain amyloidosisplasma cell dyscrasiaextracellularimmunoglobulinBudd-Chiari syndromeAL amyloidosis
Journal Article 2024-02-01 ✓ 1 Snippet Zhang X, Tang F, Gao YY, Song DZ, Liang J.
In-Text Gene Mentions

…atolenticular degeneration andhemochromatosis.…

Show Full Abstract

<h4>Background</h4>Light chain (AL) amyloidosis is a plasma cell dyscrasia characterized by the pathologic production and extracellular tissue deposition of fibrillar proteins derived from immunoglobulin AL fragments secreted by a clone of plasma cells, which leads to progressive dysfunction of the affected organs. The two most commonly affected organs are the heart and kidneys, and liver is rarely the dominant affected organ with only 3.9% of cases, making them prone to misdiagnosis and missed diagnosis.<h4>Case summary</h4>A 65-year-old woman was admitted with a 3-mo history of progressive jaundice and marked hepatomegaly. Initially, based on enhanced computed tomography scan and angiography, Budd-Chiari syndrome was considered and balloon dilatation of significant hepatic vein stenoses was performed. However, additional diagnostic procedures, including liver biopsy and bone marrow-examination, revealed immunoglobulin kapa AL amyloidosis with extensive liver involvement and hepatic vascular compression. The disease course was progressive and fatal, and the patient eventually died 5 mo after initial presentation of symptoms.<h4>Conclusion</h4>AL amyloidosis with isolated liver involvement is very rare, and can be easily misdiagnosed as a vascular disease.

Also flagged:Hereditary angioedemaC1 inhibitorbradykinincatabolismkininSplicing
Journal Article 2024-02-01 No Snippets Vincent D, Parsopoulou F, Martin L, Gaboriaud C, Demongeot J, Loules G, Fischer S, Cichon S, Germenis AE, Ghannam A, Drouet C.
Show Full Abstract

<h4>Background</h4>Hereditary angioedema (HAE) is a potentially life-threatening disorder characterized by recurrent episodes of subcutaneous or submucosal swelling. HAE with normal C1 inhibitor (HAE-nC1-INH) is an underdiagnosed condition. Although the association with genetic variants has been identified for some families, the genetic causes in many patients with HAE-nC1-INH remain unknown. The role of genes associated with bradykinin catabolism is not fully understood.<h4>Objective</h4>We sought to investigate the biological parameters and the genes related to kallikrein-kinin system in families with a clinical phenotype of HAE-nC1-INH and presenting with a carboxypeptidase N (CPN) deficiency.<h4>Methods</h4>This study includes 4 families presenting with HAE-nC1-INH and CPN deficiency. Patients' clinical records were examined, biological parameters of kallikrein-kinin system were measured, and genetics was analyzed by next-generation sequencing and Sanger sequencing. Predictive algorithms (Human Splicing Finder, Sorting Intolerant From Tolerant, Polymorphism Phenotyping v2, MutationTaster, and ClinPred) were used to classify variants as affecting splicing, as benign to deleterious, or as disease-causing.<h4>Results</h4>Patients presented with angioedema and urticaria, mainly on face/lips, but also with abdominal pain or laryngeal symptoms. Affected patients displayed low CPN activity-30% to 50% of median value in plasma. We identified 3 variants of the <i>CPN1</i> gene encoding the catalytic 55-kDa subunit of CPN: c.533G>A, c.582A>G, and c.734C>T. CPN deficiency associated with genetic variants segregated with HAE-nC1-INH symptoms in affected family members.<h4>Conclusions</h4><i>CPN1</i> gene variants are associated with CPN deficiency and HAE-nC1-INH symptoms in 4 unrelated families. Genetic CPN deficiency may contribute to bradykinin and anaphylatoxin accumulation, with synergistic effects in angioedema and urticarial symptoms.

Also flagged:Lung AdenocarcinomacancerNon-small cell lung cancerNSCLCadenocarcinomaFAT atypical cadherin 1
Journal Article 2024-02-01 No Snippets Ding C, Zhao W, Huang H, Li Y, Zhang Z, Zhang R, Wang Y, Wu D, Chen C, Liu H, Chen J.
Show Full Abstract

<h4>Background</h4>Lung cancer is a leading cause of cancer-related deaths. Non-small cell lung cancer (NSCLC) is the most common pathological subtype, with adenocarcinoma being the predominant type. FAT atypical cadherin 1 (FAT1) is a receptor-like protein with a high frequency of mutations in lung adenocarcinoma. The protein encoded by FAT1 plays a crucial role in processes such as cell adhesion, proliferation, and differentiation. This study aims to investigate the expression of FAT1 in lung adenocarcinoma and its relationship with immune infiltration.<h4>Methods</h4>Gene expression levels and relevant clinical information of 513 lung adenocarcinoma samples and 397 adjacent lung samples were obtained through The Cancer Genome Atlas (TCGA) and Genotype-Tissue Expression (GTEx) data. The mRNA expression levels of the FAT1 gene in lung adenocarcinoma tissues were analyzed, along with its association with the prognosis of lung adenocarcinoma patients. Pathway enrichment analysis was conducted to explore the signaling pathways regulated by the FAT1 gene. Immunoblotting was used to detect the differential expression of FAT1 in lung epithelial cells and various lung cancer cell lines, while immunohistochemistry was employed to assess FAT1 expression in lung cancer and adjacent tissues.<h4>Results</h4>FAT1 gene mutations were identified in 14% of lung adenocarcinoma patients. TCGA database data revealed significantly higher FAT1 mRNA expression in lung adenocarcinoma tissues compared to adjacent lung tissues. Kaplan-Meier analysis indicated lower survival rates in lung adenocarcinoma patients with higher FAT gene expression. Pathway enrichment analysis suggested the involvement of FAT1 in tumor development pathways, and its expression was closely associated with immune cell infiltration. Immunohistochemical validation demonstrated significantly higher expression of FAT1 in cancer tissues compared to adjacent lung tissues.<h4>Conclusions</h4>FAT1 mRNA is highly expressed in lung adenocarcinoma tissues, and elevated FAT1 mRNA expression is associated with poor prognosis in lung adenocarcinoma patients. FAT1 may serve as a potential biomarker for lung cancer.

Also flagged:hepatocellular carcinomatumorimmune responsegene expressionVTCN1TNFSF9
Journal Article 2024-02-01 No Snippets Li MT, Zheng KF, Qiu YE.
Show Full Abstract

<h4>Background</h4>The development and progression of hepatocellular carcinoma (HCC) have been reported to be associated with immune-related genes and the tumor microenvironment. Nevertheless, there are not enough prognostic biomarkers and models available for clinical use. Based on seven prognostic genes, this study calculated overall survival in patients with HCC using a prognostic survival model and revealed the immune status of the tumor microenvironment (TME).<h4>Aim</h4>To develop a novel immune cell-related prognostic model of HCC and depict the basic profile of the immune response in HCC.<h4>Methods</h4>We obtained clinical information and gene expression data of HCC from The Cancer Genome Atlas (TCGA) and International Cancer Genome Consortium (ICGC) datasets. TCGA and ICGC datasets were used for screening prognostic genes along with developing and validating a seven-gene prognostic survival model by weighted gene coexpression network analysis and least absolute shrinkage and selection operator regression with Cox regression. The relative analysis of tumor mutation burden (TMB), TME cell infiltration, immune checkpoints, immune therapy, and functional pathways was also performed based on prognostic genes.<h4>Results</h4>Seven prognostic genes were identified for signature construction. Survival receiver operating characteristic curve analysis showed the good performance of survival prediction. TMB could be regarded as an independent factor in HCC survival prediction. There was a significant difference in stromal score, immune score, and estimate score between the high-risk and low-risk groups stratified based on the risk score derived from the seven-gene prognostic model. Several immune checkpoints, including VTCN1 and TNFSF9, were found to be associated with the seven prognostic genes and risk score. Different combinations of checkpoint blockade targeting inhibitory CTLA4 and PD1 receptors and potential chemotherapy drugs hold great promise for specific HCC therapies. Potential pathways, such as cell cycle regulation and metabolism of some amino acids, were also identified and analyzed.<h4>Conclusion</h4>The novel seven-gene (<i>CYTH3, ENG, HTRA3, PDZD4, SAMD14, PGF</i>, and <i>PLN</i>) prognostic model showed high predictive efficiency. The TMB analysis based on the seven genes could depict the basic profile of the immune response in HCC, which might be worthy of clinical application.

Also flagged:gastric cancertumorCD3GCDKL2cancerperitoneal metastasis
Journal Article 2024-02-01 No Snippets Wu Z, Gu T, Xiong C, Shi J, Wang J, Guo T, Xing X, Pang F, He N, Miao R, Shan F, Zhou Y, Li Z, Ji J.
Show Full Abstract

<h4>Objective</h4>Positive peritoneal lavege cytology (CY1) gastric cancer is featured by dismal prognosis, with high risks of peritoneal metastasis. However, there is a lack of evidence on pathogenic mechanism and signature of CY1 and there is a continuous debate on CY1 therapy. Therefore, exploring the mechanism of CY1 is crucial for treatment strategies and targets for CY1 gastric cancer.<h4>Methods</h4>In order to figure out specific driver genes and marker genes of CY1 gastric cancer, and ultimately offer clues for potential marker and risk assessment of CY1, 17 cytology-positive gastric cancer patients and 31 matched cytology-negative gastric cancer patients were enrolled in this study. The enrollment criteria were based on the results of diagnostic laparoscopy staging and cytology inspection of exfoliated cells. Whole exome sequencing was then performed on tumor samples to evaluate genomic characterization of cytology-positive gastric cancer.<h4>Results</h4>Least absolute shrinkage and selection operator (LASSO) algorithm identified 43 cytology-positive marker genes, while MutSigCV identified 42 cytology-positive specific driver genes. <i>CD3G</i> and <i>CDKL2</i> were both driver and marker genes of CY1. Regarding mutational signatures, driver gene mutation and tumor subclone architecture, no significant differences were observed between CY1 and negative peritoneal lavege cytology (CY0).<h4>Conclusions</h4>There might not be distinct differences between CY1 and CY0, and CY1 might represent the progression of CY0 gastric cancer rather than constituting an independent subtype. This genomic analysis will thus provide key molecular insights into CY1, which may have a direct effect on treatment recommendations for CY1 and CY0 patients, and provides opportunities for genome-guided clinical trials and drug development.

DCC
Also flagged:TP53gastric cancertumorsuppressor geneCDH1E-cadherin
Journal Article 2024-02-01 ✓ 1 Snippet Cai HQ, Zhang LY, Fu LM, Xu B, Jiao Y.
In-Text Gene Mentions

…TP53, APC, andDCCare shut down[…

Show Full Abstract

In this editorial we comment on an article published in a recent issue of the <i>World J Gastrointest Surg</i>. A common gene mutation in gastric cancer (GC) is the TP53 mutation. As a tumor suppressor gene, TP53 is implicated in more than half of all tumor occurrences. TP53 gene mutations in GC tissue may be related with clinical pathological aspects. The TP53 mutation arose late in the progression of GC and aided in the final switch to malignancy. CDH1 encodes E-cadherin, which is involved in cell-to-cell adhesion, epithelial structure maintenance, cell polarity, differentiation, and intracellular signaling pathway modulation. CDH1 mutations and functional loss can result in diffuse GC, and CDH1 mutations can serve as independent prognostic indicators for poor prognosis. GC patients can benefit from genetic counseling and testing for CDH1 mutations. Demethylation therapy may assist to postpone the onset and progression of GC. The investigation of TP53 and CDH1 gene mutations in GC allows for the investigation of the relationship between these two gene mutations, as well as providing some basis for evaluating the prognosis of GC patients.

PRDX6
Also flagged:Phospholipase A2PLA2G2APLA2G12BlipidmembranePLA2
Journal Article 2024-02-01 ✓ 1 Snippet Qiu C, Xiang YK, Da XB, Zhang HL, Kong XY, Hou NZ, Zhang C, Tian FZ, Yang YL.
In-Text Gene Mentions

…PNPLA7, PNPLA8, andPRDX6were predominantly down-regula…

Show Full Abstract

<h4>Background</h4>Phospholipase A2 (PLA2) enzymes are pivotal in various biological processes, such as lipid mediator production, membrane remodeling, bioenergetics, and maintaining the body surface barrier. Notably, these enzymes play a significant role in the development of diverse tumors.<h4>Aim</h4>To systematically and comprehensively explore the expression of the PLA2 family genes and their potential implications in cholangiocarcinoma (CCA).<h4>Methods</h4>We conducted an analysis of five CCA datasets from The Cancer Genome Atlas and the Gene Expression Omnibus. The study identified differentially expressed genes between tumor tissues and adjacent normal tissues, with a focus on PLA2G2A and PLA2G12B. Gene Set Enrichment Analysis was utilized to pinpoint associated pathways. Moreover, relevant hub genes and microRNAs for PLA2G2A and PLA2G12B were predicted, and their correlation with the prognosis of CCA was evaluated.<h4>Results</h4>PLA2G2A and PLA2G12B were discerned as differentially expressed in CCA, manifesting significant variations in expression levels in urine and serum between CCA patients and healthy individuals. Elevated expression of PLA2G2A was correlated with poorer overall survival in CCA patients. Additionally, the study delineated pathways and miRNAs associated with these genes.<h4>Conclusion</h4>Our findings suggest that PLA2G2A and PLA2G12B may serve as novel potential diagnostic and prognostic markers for CCA. The increased levels of these genes in biological fluids could be employed as non-invasive markers for CCA, and their expression levels are indicative of prognosis, underscoring their potential utility in clinical settings.

Also flagged:autoinflammatory keratinization diseaseskeratinization diseasesinnate immunityinflammatory keratinization diseaseshyperkeratosisgeneralized pustular psoriasis
Journal Article 2024-02-01 No Snippets Akiyama M.
Show Full Abstract

Whole-exome and whole-genome sequencing have become widespread in approximately the last 15 years, and the predisposing factors and pathomechanisms of inflammatory keratinization diseases, which have been unknown for a long time, have gradually been revealed. Hence, various inflammatory keratinization diseases are recognized to cause innate immunity hyperactivation. Therefore, we have been advocating for the clinical entity, "autoinflammatory keratinization diseases (AiKDs)" since 2017. AiKDs are inflammatory keratinization diseases caused by autoinflammatory-related pathomechanisms in the skin. The aberrant activation of innate immunity and the resultant autoinflammation in the epidermis and the superficial dermis in AiKDs cause hyperkeratosis in the epidermis. Our initially proposed concept of AiKDs included generalized pustular psoriasis and related conditions, pityriasis rubra pilaris type V, and familial keratosis lichenoides chronica. Since then, the number of diseases known to be AiKDs has increased as previously unknown disease-causing factors and pathogenetic mechanisms of inflammatory keratinization diseases have been clarified one by one. To date, porokeratosis, hidradenitis suppurative, keratosis linearis with ichthyosis congenita and sclerosing keratoderma (KLICK) syndrome, and AiKDs associated with epidermal growth factor receptor (EGFR) deficiency or with hepatitis and autism have been recognized as AiKDs. The concept of AiKDs is considered extremely useful in our precise understanding of the pathogeneses behind inflammatory keratinization diseases and our appropriate treatment method selection. The number of AiKDs is expected to grow with the clarification of the pathomechanisms of further inflammatory keratinization diseases.

DCC
Also flagged:ROBO3horizontal gaze palsyscoliosis
Journal Article 2024-02-01 ✓ 1 Snippet Xie Y, Huang L, Zhou Y, Wu J, Li N.
In-Text Gene Mentions

HGPPS2 (OMIM1#617542) is caused by mutations of the DCC gene and distinguished from HGPPS1 by impaired intellectual development, global developmental delay, agenesis of the corpus callosum, and absence of the anterior and hippocampal commissures.3, 4

Show Full Abstract

No abstract available.

HFE
Also flagged:Cronkhite-Canada syndromealopeciaanemiahypoalbuminemiahypocalcemiahypokalemia
Journal Article 2024-02-01 ✓ 1 Snippet Tang YC.
In-Text Gene Mentions

…Peutz-Jegher syndrome (PJS),hemochromatosisand some connective…

Show Full Abstract

<h4>Background</h4>Cronkhite-Canada syndrome (CCS) is a rare, noninherited disease characterized by gastrointestinal polyposis with diarrhea and ectodermal abnormalities. CCS polyps are distributed through the whole digestive tract, and they are common in the stomach and colon but very uncommon in the esophagus.<h4>Case summary</h4>Here, we present a case of a 63-year-old man with skin hyperpigmentation accompanied by diarrhea, alopecia, and loss of his fingernails. Laboratory data indicated anemia, hypoalbuminemia, hypocalcemia, hypokalemia, and positive fecal occult blood. Endoscopy showed numerous polyps scattered throughout the digestive tract, including the esophagus. He was treated with nutritional support and glucocorticoids with remission of his symptoms.<h4>Conclusion</h4>Comprehensive treatment led by hormonal therapy can result in partial or full remission of clinical symptoms. Treatment should be individualized for each patient according to their therapy response. Surveillance endoscopy is necessary for assessing mucosal disease activity and detecting malignant transformation.

PRDX6
Also flagged:translationalovarian cancercell proliferationIL-2secretiondeath
Journal Article 2024-02-01 ✓ 1 Snippet Zhang J, Yin Z, Liang Z, Bai Y, Zhang T, Yang J, Li X, Xue L.
In-Text Gene Mentions

…of SELENOT ,PRDX6, TXN2 ,…

Show Full Abstract

<h4>Background</h4>Mononuclear cells in peripheral blood and ascites are important clinical resources commonly used in translational and basic research. However, the impact of different cryopreservation durations and extra freeze-thaw cycles on the number and function of mononuclear cells is unknown.<h4>Methods</h4>Peripheral blood samples (<i>n</i> = 21) and ascites samples (<i>n</i> = 8) were collected from healthy volunteers and ovarian cancer patients. Mononuclear cells were isolated, frozen, and thawed at 6 and 12 months. The impact of cryopreservation on cell viability, the phenotype, and the activation and proliferation of T cells were analyzed by flow cytometry. Single-cell sequencing was applied to investigate the underlying mechanism.<h4>Results</h4>The cell number and viability of mononuclear cells in peripheral blood and ascites were significantly decreased after cryopreservation. The T lymphocytes, especially CD4<sup>+</sup> T cells, were affected the most significantly. By contrast, monocytes, natural killer (NK) cells, natural killer T (NKT) cells, and B cells were more tolerant. Meanwhile, T cell proliferation and IL-2 secretion are significantly affected after long-term cryopreservation. Mechanistically, the cell death induced by elevated reactive oxygen species (ROS) was involved in the reduction of CD4<sup>+</sup> T cells after cryopreservation.<h4>Conclusions</h4>Our data indicates that different subtypes of mononuclear cells exhibit different tolerance capacities upon cryopreservation. Thus, our research can provide evidence and support for individuals who are conducting experiments using frozen clinical patient-derived mononuclear cells, for basic research or clinical trials. In addition, extra caution is worthwhile when researchers compare immune cell functionality from peripheral blood or ascites across datasets obtained in different cryopreservation conditions.

ECI2
Also flagged:Gene ExpressionEDfatty acidmetabolismdegradationerectile dysfunction
Journal Article 2024-02-01 ✓ 3 Snippets He Y, Liu C, Zheng Z, Gao R, Lin H, Zhou H.
In-Text Gene Mentions

Coexpression analysis and gene set enrichment analysis of hub FAMDEGs were performed.<h4>Outcome</h4>Fatty acid metabolism-related functions (such as fatty acid metabolism and degradation) may play a vital role in ED.<h4>Results</h4>In total, 5 hub FAMDEGs (<i>Aldh2</i>, <i>Eci2</i>, <i>Acat1</i>, <i>Acadl</i>, and <i>Hadha</i>) were identified and found to be differentially expressed between ED and normal samples.

…( Aldh2 ,Eci2, Acat1 ,…

Eci2

Show Full Abstract

<h4>Background</h4>Erectile dysfunction (ED) is a common condition affecting middle-aged and elderly men.<h4>Aim</h4>The study sought to investigate differentially expressed fatty acid metabolism-related genes and the molecular mechanisms of ED.<h4>Methods</h4>The expression profiles of GSE2457 and GSE31247 were downloaded from the Gene Expression Omnibus database and merged. Differentially expressed genes (DEGs) between ED and normal samples were obtained using the R package limma. Gene Ontology and Kyoto Encyclopedia of Genes and Genomes enrichment analyses of DEGs were conducted using the R package clusterProfiler. Fatty acid metabolism-related DEGs (FAMDEGs) were further identified and analyzed. Machine learning algorithms, including Lasso (least absolute shrinkage and selection operator), support vector machine, and random forest algorithms, were utilized to identify hub FAMDEGs with the ability to predict ED occurrence. Coexpression analysis and gene set enrichment analysis of hub FAMDEGs were performed.<h4>Outcome</h4>Fatty acid metabolism-related functions (such as fatty acid metabolism and degradation) may play a vital role in ED.<h4>Results</h4>In total, 5 hub FAMDEGs (<i>Aldh2</i>, <i>Eci2</i>, <i>Acat1</i>, <i>Acadl</i>, and <i>Hadha</i>) were identified and found to be differentially expressed between ED and normal samples. Gene set enrichment analysis identified key pathways associated with these genes. The area under the curve values of the 5 hub FAMDEGs for predicting ED occurrence were all >0.8.<h4>Clinical translation</h4>Our results suggest that these 5 key FAMDEGs may serve as biomarkers for the diagnosis and treatment of ED.<h4>Strengths and limitations</h4>The strengths of our study include the use of multiple datasets and machine learning algorithms to identify key FAMDEGs. However, limitations include the lack of validation in animal models and human tissues, as well as research on the mechanisms of these FAMDEGs.<h4>Conclusion</h4>Five hub FAMDEGs were identified as potential biomarkers for ED progression. Our work may prove that fatty acid metabolism-related genes are worth further investigation in ED.

Also flagged:Oral cancercancerOSCCoral cancersleucoplakiaerythroplakia
Journal Article 2024-02-01 No Snippets Rajendran P, Sekar R, Abdallah BM, Fathima Jh S, Ali EM, Jayaraman S, Abdelsalam SA, Veeraraghavan V.
Show Full Abstract

Oral squamous cell carcinoma (OSCC) showed a seemingly increasing incidence in the last decade. In India, despite the use of tobacco decreased rapidly, in the past five years, the incidence pattern of OSCC over gender and age showed a drastic shift. About 51 % of the head and neck cancers are not associated with habits. Studies exploring various contributing factors in the incidence of this malignancy have documented. Recently, the epigenetic factors associated with the induction and progression of OSCC were explored. More than 90 % of the human genome is made up of non-coding transcriptome, which believed to be noises. However, these non-coding RNAs were identified to be the major epigenetic modulators, which raises concern over incidence of carcinoma in non-habit patients. H19 is a long non coding RNA which proved to be an effective biomarker in various carcinoma. Its role in oral squamous cell cancer was not investigated in depth. This review discusses in detail the various epigenetic role of H19 in inducing oral carcinogenesis.

DCC
Also flagged:Netrin-1NeuronBone Cancermetastatic bone cancerpolymerasedeleted in
Journal Article 2024-02-01 ✓ 5 Snippets Gong Z, Zhang Y, Wang W, Li X, Wang K, You X, Wu J.
In-Text Gene Mentions

Netrin-1 Role in Nociceptive Neuron Sprouting through Activation of DCC Signaling in a Rat Model of Bone Cancer Pain.

…through Activation ofDCCSignaling in a…

…in colorectal cancer (DCC) signaling was inhibited…

…intrathecal injection ofDCC-siRNA.<h4>Results</h4>In BCP …

…its attractive receptorDCC.…

Show Full Abstract

<h4>Background</h4>Bone cancer pain (BCP) is a common primary or metastatic bone cancer complication. Netrin-1 plays an essential role in neurite elongation and pain sensitization. This study aimed to determine the role of netrin-1 from the metastatic bone microenvironment in BCP development and identify the associated signaling pathway for the strategy of BCP management.<h4>Methods</h4>The rat BCP model was established by intratibial implantation of Walker 256 cells. Von Frey filaments measured the mechanical pain threshold. Movement-induced pain was assessed using limb use scores. Expressions of associated molecules in the affected tibias or dorsal root ganglia (DRG) were measured by immunofluorescence, immunohistochemistry, real-time quantitative polymerase chain reaction, or western blotting. Transduction of deleted in colorectal cancer (DCC) signaling was inhibited by intrathecal injection of DCC-siRNA.<h4>Results</h4>In BCP rats, the presence of calcitonin gene-related peptide (CGRP)-positive nerve fibers increased in the metastatic bone lesions. The metastatic site showed enrichment of well-differentiated osteoclasts and expressions of netrin-1 and its attractive receptor DCC. Upregulation of DCC and increased phosphorylation levels of focal adhesion kinase (FAK) and Rac family small GTPase 1/Cell division cycle 42 (Rac1/Cdc42) were found in the DRG. Intrathecal administration of DCC-siRNA led to a significant reduction in FAK and Rac1/Cdc42 phosphorylation levels in the DRG, decreased nociceptive nerve innervation, and improved pain behaviors.<h4>Conclusions</h4>Netrin-1 may contribute to the activation of the BCP by inducing nociceptive nerve innervation and improving pain behaviors.

PRDX6
Also flagged:Hepatocellular Carcinomaliver cancerPI3KAktmTORNotch
Journal Article 2024-02-01 ✓ 5 Snippets Mu R, Chang M, Feng C, Cui Y, Li T, Liu C, Wang Y, Guo X.
In-Text Gene Mentions

The expression levels of PI3K, p-Akt, p-mTOR, Notch1, and Hes1 proteins in the sh-<i>PRDX6</i> group were significantly lower than those in WT and sh-NC groups (<i>P</i> < 0.05).<h4>Conclusion</h4>The expression of <i>PRDX6</i> may be closely related to the prognosis of HCC.

CCK8 method was used to detect the proliferation activity of HepG2 cells, scratch healing test was used to detect the migration ability, Transwell chamber was used to detect the invasion ability, and Western blot was used to detect the expression levels of PI3K/Akt/mTOR signaling pathway and Notch signaling pathway-related proteins.<h4>Results</h4>The expression of <i>PRDX6</i> was significantly correlated with the gender, race, clinical stage, histological grade, and survival time of HCC patients (<i>P</i> < 0.05).

…the mechanism ofPRDX6in liver cancer…

…the Expression ofPRDX6in Patients with…

…the expression ofPRDX6mRNA in hepatocellular…

Show Full Abstract

<h4>Objectives</h4>This research aimed to study the expression of <i>PRDX6</i> mRNA in hepatocellular carcinoma (HCC) and its effect on the prognosis of HCC. Moreover, the effect of <i>PRDX6</i> gene knockdown on the proliferation, migration, and invasion of HepG2 cells mediated by lentivirus was also examined. This study offers a theoretical and experimental basis for further research on the mechanism of PRDX6 in liver cancer and new methods for clinical diagnosis and treatment.<h4>Methods</h4>RNA sequence data of 369 HCC patients were screened through the TCGA database, and the expression and clinical characteristics of <i>PRDX6</i> mRNA were analyzed based on high-throughput RNA sequencing data. HepG2 cells were divided into WT, sh-NC and sh-<i>PRDX6</i> groups. Real-time PCR and Western blot were used to detect the expression levels of the <i>PRDX6</i> gene and protein, respectively. CCK8 method was used to detect the proliferation activity of HepG2 cells, scratch healing test was used to detect the migration ability, Transwell chamber was used to detect the invasion ability, and Western blot was used to detect the expression levels of PI3K/Akt/mTOR signaling pathway and Notch signaling pathway-related proteins.<h4>Results</h4>The expression of <i>PRDX6</i> was significantly correlated with the gender, race, clinical stage, histological grade, and survival time of HCC patients (<i>P</i> < 0.05). Compared with that in WT and sh-NC groups, the expression level of <i>PRDX6</i> protein in HCC patients was significantly lower (<i>P</i> < 0.01), the proliferation activity of HCC cells was significantly decreased (<i>P</i> < 0.05), and the migration and invasion ability was significantly decreased (<i>P</i> < 0.05) in the sh-<i>PRDX6</i> group. The expression levels of PI3K, p-Akt, p-mTOR, Notch1, and Hes1 proteins in the sh-<i>PRDX6</i> group were significantly lower than those in WT and sh-NC groups (<i>P</i> < 0.05).<h4>Conclusion</h4>The expression of <i>PRDX6</i> may be closely related to the prognosis of HCC. Lentivirus-mediated <i>PRDX6</i> knockdown can inhibit the proliferation, migration and invasion of HCC cells, which may be related to its regulating the PI3K/Akt/mTOR and Notch1 signaling pathways. <i>PRDX6</i> is expected to be a new target for the diagnosis and treatment of liver cancer.

HFE
Also flagged:liver fibrosisExtracellularliver damagecirrhosishepatocellular carcinomairon
Journal Article 2024-02-01 ✓ 5 Snippets Ahmadi Badi S, Bereimipour A, Rohani P, Khatami S, Siadat SD.
In-Text Gene Mentions

The hemochromatosis may result from HFE and TFR2 mutations in relatively mild phenotypes (Chen et al. 2016).

…ion, Hemochromatosis Protein (HFE) and Transferrin Receptor…

…Iron overload inducesHFEand TFR2 to…

…Thehemochromatosismay result from…

…may result fromHFEand TFR2 mutations…

Show Full Abstract

<h4>Introduction</h4>There is a proven role for hepcidin and the composition of gut microbiota and its derivatives in the pathophysiology of liver fibrosis.<h4>Area covered</h4>This review focuses on the literature search regarding the effect of hepcidin and gut microbiota on regulating liver physiology. We presented the regulating mechanisms of hepcidin expression and discussed the possible interaction between gut microbiota and hepcidin regulation. Furthermore, we investigated the importance of the hepcidin gene in biological processes and bacterial interactions using bioinformatics analysis.<h4>Expert opinion</h4>One of the main features of liver fibrosis is iron accumulation in hepatic cells, including hepatocytes. This accumulation can induce an oxidative stress response, inflammation, and activation of hepatic stellate cells. Hepcidin is a crucial regulator of iron by targeting ferroportin expressed on hepatocytes, macrophages, and enterocytes. Various stimuli, such as iron load and inflammatory signals, control hepcidin regulation. Furthermore, a bidirectional relationship exists between iron and the composition and metabolic activity of gut microbiota. We explored the potential of gut microbiota to influence hepcidin expression and potentially manage liver fibrosis, as the regulation of iron metabolism plays a crucial role in this context.

Also flagged:methylationhistonechromatinmetalsdefense responsetranscriptional regulators
Journal Article 2024-02-01 No Snippets Siddique AB, Parveen S, Rahman MZ, Rahman J.
Show Full Abstract

Highly repetitive adverse environmental conditions are encountered by plants multiple times during their lifecycle. These repetitive encounters with stresses provide plants an opportunity to remember and recall the experiences of past stress-associated responses, resulting in better adaptation towards those stresses. In general, this phenomenon is known as plant stress memory. According to our current understanding, epigenetic mechanisms play a major role in plants stress memory through DNA methylation, histone, and chromatin remodeling, and modulating non-coding RNAs. In addition, transcriptional, hormonal, and metabolic-based regulations of stress memory establishment also exist for various biotic and abiotic stresses. Plant memory can also be generated by priming the plants using various stressors that improve plants' tolerance towards unfavorable conditions. Additionally, the application of priming agents has been demonstrated to successfully establish stress memory. However, the interconnection of all aspects of the underlying mechanisms of plant stress memory is not yet fully understood, which limits their proper utilization to improve the stress adaptations in plants. This review summarizes the recent understanding of plant stress memory and its potential applications in improving plant tolerance towards biotic and abiotic stresses.

HTT
Also flagged:Attention Deficit DisorderADHDneurodevelopmental disorderHyperactivityAttention-deficit/hyperactivity disorderneurodevelopmental disorders
Journal Article 2024-02-01 ✓ 3 Snippets Noorazar SG, Mirzaei M, Kalejahi P.
In-Text Gene Mentions

Probably increasing the level of serotonin in the blood by consuming P. incarnata correlates with reducing the level of serotonin in the brain and a decrease in 5-HTT activity in various brain regions may be associated with reducing some symptoms of ADHD.

…decreased levels of5-HTTin the blood…

…a decrease in5-HTTactivity in various…

Show Full Abstract

<h4>Background</h4>Attention-deficit/hyperactivity disorder (ADHD) is a common neurodevelopmental disorder with a complex etiology. Stimulants as a first-line treatment are not effective in some cases. In this study, we conducted a systematic review to evaluate the efficacy of traditional Persian Iranian medicine (TIM) for children and adolescents with ADHD.<h4>Methods</h4>Data were collected mainly from PubMed, Google Scholar, Web of Science, ProQuest, and Scopus databases until Dec 2022. The keywords related to ADHD, traditional Persian medicine (TPM), and (TIM) were searched. Two reviewers independently screened 714 abstracts and eventually, eight trials were included in the systematic reviews. Changes in the severity of ADHD symptoms were considered based on the validated cutoff on recognized rating scales as the result of the effect of TIM on ADHD.<h4>Results</h4>Interventions included herbal extracts of <i>Passiflora incarnate</i>, whey protein, <i>Ginkgo biloba, Crocus sativus L</i>, sweet almond syrup, and horse milk. In all studies, except <i>G. biloba</i>, there was evidence of a reduction in the severity of ADHD. Low evidence could be found for <i>G. biloba</i>.<h4>Conclusion</h4>Herbal and traditional remedies are an efficient and safe solution to alleviate the symptoms of ADHD. In future studies, TIM as a complementary therapy may be useful to alleviate ADHD symptoms, especially in children who are resistant to stimulant medications.

HFE
Also flagged:infectioncirrhosishepatocellular carcinomachronic hepatitis Balanine aminotransferaseALT
Journal Article 2024-02-01 ✓ 1 Snippet Xiong QF, Zou L, Chen ZJ, Liu HL, Lu YJ, Liu DX, Yang YF.
In-Text Gene Mentions

…cholestasis (PFIC), 15hemochromatosis, 16 idiopathic portal…

Show Full Abstract

Background/Aims: Recent studies revealed that patients with persistent aminotransferase elevations after antiviral treatment had higher risk of hepatic events; yet its underlying causes remain unclear. Our study aimed to investigate the etiologies of persistent aminotransferase elevations in patients treated with nucleos(t)ide analogs (NAs). Materials and Methods: A retrospective study was conducted on chronic hepatitis B (CHB) patients who had been receiving NA treatment for over a year and had an aminotransferase level greater than 40 IU/mL (more than twice, with a 3-month interval) and subsequently underwent a liver biopsy. Results: The study group included 46 patients (34 males) with a mean age of 44.8 ± 20.3 years (range: 24-71 years).The average dura- tion of NA therapy was 3.7 years (1.1-10.6 years). The etiologies of persistant transaminase elevation were categorized into 4 groups: patients with low hepatitis B virus (HBV) viral load (LVL, n = 11); concurrent non-alcoholic fatty liver disease (NAFLD, n = 12); concurrent other liver diseases (OLD, n = 12); and unknown liver dysfunction (ULD, n = 11). The proportion of G ≥ 2 inflammation was significantly higher in the LVL group (90.9%) compared to NAFLD (33.3%), OLD (50%), and ULD (27.2%) groups (P = .012). The hepatitis B e-antigen (HBeAg)-positive group exhibited a younger age (34.5 ± 10.2 vs. 48.1 ± 9.4 years, P < .001), a lower proportion of fibrosis F ≥ 2 (36.3% vs. 77.1%, P = .012), and a higher prevalence of detectable HBV DNA (54.5% vs.14.2%, P = .00632) compared to the HBeAg-negative group. Conclusion: The etiology of persistent aminotransferase elevations in CHB patients undergoing NAs treatment warrants investigation. Besides the commonly observed NAFLD and low HBV viral load, concurrent presence of other liver diseases requires elucidation.The proportion of G≥2 inflammation was higher in the LVL group.

OLFM4
Also flagged:NucleusHematoxylincytoplasmsegmentationmembranesER
Journal Article 2024-02-01 ✓ 1 Snippet Remedios LW, Bao S, Remedios SW, Lee HH, Cai LY, Li T, Deng R, Cui C, Li J, Liu Q, Lau KS, Roland JT, Washington MK, Coburn LA, Wilson KT, Huo Y, Landman BA.
In-Text Gene Mentions

OLFM4

Show Full Abstract

Understanding the way cells communicate, co-locate, and interrelate is essential to understanding human physiology. Hematoxylin and eosin (H&E) staining is ubiquitously available both for clinical studies and research. The Colon Nucleus Identification and Classification (CoNIC) Challenge has recently innovated on robust artificial intelligence labeling of six cell types on H&E stains of the colon. However, this is a very small fraction of the number of potential cell classification types. Specifically, the CoNIC Challenge is unable to classify epithelial subtypes (progenitor, endocrine, goblet), lymphocyte subtypes (B, helper T, cytotoxic T), or connective subtypes (fibroblasts, stromal). In this paper, we propose to use inter-modality learning to label previously un-labelable cell types on virtual H&E. We leveraged multiplexed immunofluorescence (MxIF) histology imaging to identify 14 subclasses of cell types. We performed style transfer to synthesize virtual H&E from MxIF and transferred the higher density labels from MxIF to these virtual H&E images. We then evaluated the efficacy of learning in this approach. We identified helper T and progenitor nuclei with positive predictive values of 0.34 ± 0.15 (prevalence 0.03 ± 0.01) and 0.47 ± 0.1 (prevalence 0.07 ± 0.02) respectively on virtual H&E. This approach represents a promising step towards automating annotation in digital pathology.

HTT
Also flagged:coronavirus disease 2019COVID-19infectious diseasesZikaEbolanon-communicable diseases
Journal Article 2024-02-01 ✓ 1 Snippet Feng Y, Su C, Mao G, Sun B, Cai Y, Dai J, Ma Y.
In-Text Gene Mentions

…[ 132 ],HTT[ 133 ],…

Show Full Abstract

In recent years, the world has faced significant challenges with the coronavirus disease 2019 (COVID-19) pandemic, as well as other infectious diseases such as Zika and Ebola. Furthermore, the rapid rise of non-communicable diseases such as diabetes, heart disease, and cancer has placed tremendous strain on healthcare resources and systems. Unfortunately, advancements in drug development, diagnostics, and therapeutics have struggled to keep pace with the emergence and progression of diseases, necessitating the exploration of new technologies for the discovery and development of biomedicines and biotherapies. Synthetic biology, a revolutionary field in modern science, holds great promise in advancing drug development and disease treatment. This review provides a comprehensive overview of recent developments in the application of synthetic biology to medicine, with a specific focus on its role in drug discovery, drug production, and the diagnosis and treatment of various diseases.

ECI2
Also flagged:Nucleisegmentationcancertumornucleustumors
Journal Article 2024-02-01 ✓ 1 Snippet Chen J, Wang Y, Deng R, Liu Q, Cui C, Yao T, Liu Y, Zhong J, Fogo AB, Yang H, Zhao S, Huo Y.
In-Text Gene Mentions

Eci2

Show Full Abstract

Podocytes, specialized epithelial cells that envelop the glomerular capillaries, play a pivotal role in maintaining renal health. The current description and quantification of features on pathology slides are limited, prompting the need for innovative solutions to comprehensively assess diverse phenotypic attributes within Whole Slide Images (WSIs). In particular, understanding the morphological characteristics of podocytes, terminally differentiated glomerular epithelial cells, is crucial for studying glomerular injury. This paper introduces the Spatial Pathomics Toolkit (SPT) and applies it to podocyte pathomics. The SPT consists of three main components: (1) instance object segmentation, enabling precise identification of podocyte nuclei; (2) pathomics feature generation, extracting a comprehensive array of quantitative features from the identified nuclei; and (3) robust statistical analyses, facilitating a comprehensive exploration of spatial relationships between morphological and spatial transcriptomics features. The SPT successfully extracted and analyzed morphological and textural features from podocyte nuclei, revealing a multitude of podocyte morphomic features through statistical analysis. Additionally, we demonstrated the SPT's ability to unravel spatial information inherent to podocyte distribution, shedding light on spatial patterns associated with glomerular injury. By disseminating the SPT, our goal is to provide the research community with a powerful and user-friendly resource that advances cellular spatial pathomics in renal pathology. The toolkit's implementation and its complete source code are made openly accessible at the GitHub repository: https://github.com/hrlblab/spatial_pathomics.

Abstracts

CACNA1EHTT
Also flagged:Amyotrophic Lateral SclerosisEdaravoneParkinson's diseasecarvedilolBehaviorIodine
Journal Article 2024-02-01 ✓ 2 Snippets Unknown Authors
In-Text Gene Mentions

HTT

CACNA1E

Show Full Abstract

No abstract available.

bioRxiv 2024-02-01 Preprint (No Snippets API) Schmitt-Ulms C, Kayabolen A, Manero-Carranza M, Zhou N, Donnelly K, Nuccio SP, Kato K, Nishimasu H, Gootenberg JS, Abudayyeh OO.
Show Full Abstract

RNA editing offers the opportunity to introduce either stable or transient modifications to nucleic acid sequence without permanent off-target effects, but installation of arbitrary edits into the transcriptome is currently infeasible. Here, we describe Programmable RNA Editing & Cleavage for Insertion, Substitution, and Erasure (PRECISE), a versatile RNA editing method for writing RNA of arbitrary length and sequence into existing pre-mRNAs via 5′ or 3′ trans-splicing. In trans-splicing, an exogenous template is introduced to compete with the endogenous pre-mRNA, allowing for replacement of upstream or downstream exon sequence. Using Cas7-11 cleavage of pre-mRNAs to bias towards editing outcomes, we boost the efficiency of RNA trans-splicing by 10–100 fold, achieving editing rates between 5–50% and 85% on endogenous and reporter transcripts, respectively, while maintaining high-fidelity. We demonstrate PRECISE editing across 11 distinct endogenous transcripts of widely varying expression levels, showcasing more than 50 types of edits, including all 12 possible transversions and transitions, insertions ranging from 1 to 1,863 nucleotides, and deletions. We show high efficiency replacement of exon 4 of MECP2, addressing most mutations that drive the Rett Syndrome; editing of SHANK3 transcripts, a gene involved in Autism; and replacement of exon 1 of HTT, removing the hallmark repeat expansions of Huntington′s disease. Whole transcriptome sequencing reveals the high precision of PRECISE editing and lack of off-target trans-splicing activity. Furthermore, we combine payload engineering and ribozymes for protein-free, high-efficiency trans-splicing, with demonstrated efficiency in editing HTT exon 1 via AAV delivery. We show that the high activity of PRECISE editing enables editing in non-dividing neurons and patient-derived Huntington’s disease fibroblasts. PRECISE editing markedly broadens the scope of genetic editing, is straightforward to deliver over existing gene editing tools like prime editing, lacks permanent off-targets, and can enable any type of genetic edit large or small, including edits not otherwise possible with existing RNA base editors, widening the spectrum of addressable diseases.